KEGG   Nitrospirillum viridazoti: Y958_20685
Entry
Y958_20685        CDS       T04935                                 
Name
(GenBank) hypothetical protein
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
nao  Nitrospirillum viridazoti
Brite
KEGG Orthology (KO) [BR:nao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nao03400]
    Y958_20685
DNA repair and recombination proteins [BR:nao03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Y958_20685
    Archaeal homologous recombinant proteins
     Y958_20685
SSDB
Motif
Pfam: AAA_23 SbcC_Walker_B SMC_N AAA_29 ABC_tran CLZ Cgr1 AAA_15 AAA_21 nSTAND3
Other DBs
NCBI-ProteinID: ASG23250
UniProt: A0A248JXH7
LinkDB
Position
2:complement(1685161..1688898)
AA seq 1245 aa
MQILAIRGQNIASLADKFEIDFTAEPLKSAGLFAITGKTGAGKSSILDALCLALYGDCPR
FGLTGGNEDVPDAGGEAIKARDARGVLRRGASQGHAMVDFVGLDGEAYRATWIARRARGR
VDGRLQNIERSVQRLSDGQVLDSQTRAVEAKVPALTGLTYDEFRRTVLLAQGDFDAFLRA
DTKDRGALLEKVTGTEIYRDISIRVFERYSKAKADHDLLVARRAEHQLLSEEQRTALDDE
EKALLAAIEAARAGRQVLEADVGRHKALAEAQRRHEEAVRVAADADAALVEAAGDRADLE
RIDQAEPLRLPWARARTAAASVTKAAGEVSRAQVTLEQVTQQAVARRQEQDLAQAAVNEA
ERVFKEFGPIWSKATDLDSRIVRAGQEVADAAKAAAASGEEHSKALVQLRDLIAERAQAQ
VRRQDAQAVLEARPQAAVLVRNWNQITQAFDVRHVARRSAHKARQQAGVVDAEVQKLRAA
LSESEKQDVADQATRTSLHRDILDHQERLTRLAPEVTARRVEALGDQLTVLGDLKRTSED
YDRAQTQAQTAQTSLAAAEADRDAAAKQVQDAERGIGEAEAEVKALMAPTDRALAAVSDS
AQHLRKGLVPGQPCPVCGAKEHPIHADAVLAELARDLQADLDAARERAEKSRHLLTRAQG
KVAQAEAAAKQLRTNIQEAGDRAEAAERLYGETLPKAERSDLPAGPAGAVTAILELGRQV
AEERRTLQAQLGQADELRQAITRLTTERDRLTDALEQRQGTRQRLSDEANAKGQSYALHM
QAAATAEERVETIDAGLASALEAGDLTQADLETDADEVRRVLAELVTERENAEAEALVAD
DALAALAPRISGIQARADELLRGVEKLKAAADARAEELNRLRGERAALLGGEATDVHRTR
INDARVAAIAARDEGQQKVQAAESTVATAKQALSGATTALAECQAEQVEANGVLDETLVS
GGLTAAELSEILSRPRAEVEALRTRLAALADRRTSAHAALRERQGDLATAEVAGVPELTL
EDLQQQISGIDNELSARQERVGAIRGRMQTDVQARRNLAGLEAEIAEARATFDVWQAVNS
AVGSKNGDRFVQHAQSITLDILVDRANHHLADLKPRYRLVRAGQDLAMHVVDRDMGDEVR
SVRSLSGGERFLVSLALALALSRMGGHGGLAATLFIDEGFGSLDAESLDLAIDALEALQS
QGRTVGVISHVEMMKDRIPVQVNVTRTGGGKSRVSIKGANWAQGA
NT seq 3738 nt   +upstreamnt  +downstreamnt
atgcagatcctcgccattcggggccagaacatcgccagcttggccgacaagttcgagatc
gatttcaccgctgagccactgaagtcggcgggcctgttcgccatcacgggtaaaacggga
gcgggcaagtcatccatcctggatgccctttgcctcgcgctctacggggattgtccgcgc
tttggcctgacgggtggcaatgaggatgtgcccgacgccggtggcgaggcgatcaaggct
cgtgatgcgcgcggggtcctgcgaagaggggcgtcgcaaggccatgccatggtggatttc
gtcggactcgacggcgaagcctaccgggccacctggatcgcccggcgggcgcgagggcgg
gtggatgggcgtttacagaacatcgagcgcagcgttcagcgcctatccgatggccaggtg
ctggatagtcagacgagagctgttgaggcgaaggttcccgcgctgacggggctcacgtac
gacgagttccgccgcacggtgctgttggcccagggagacttcgatgccttcctccgtgct
gacaccaaggaccgtggtgccctgcttgagaaggtgacgggcacggagatctaccgcgac
atatcgattcgcgttttcgagcgatacagcaaggcgaaggctgatcacgacctgttggtg
gctcgccgagctgagcaccagcttctgtcggaagagcaacgcacggcccttgacgacgaa
gagaaggctttgctggcggccattgaggcagcgcgagccggacgccaggtcctggaggcc
gatgtcggtcgccataaggccttggcagaagctcagcggcggcatgaagaggctgttcgg
gtcgcggccgatgcggacgccgctctcgtggaggcagcgggagatcgtgccgacctggag
cgaattgaccaggctgaaccgctccgtcttccgtgggcccgagccaggacagcggcagcc
agcgtgaccaaggcggcgggagaggtttcgcgagcgcaggtcaccttggagcaagtcacc
cagcaggctgttgcccgccgacaagagcaggacctagcgcaggctgccgtgaacgaggcc
gagcgggttttcaaggaattcggtcctatctggtccaaggccacggacctcgacagccgc
atcgtccgcgctggccaggaggtcgccgatgctgcgaaagcggccgcggcgtcgggggaa
gagcactccaaggctctggtgcagttgcgcgacctgattgccgaaagggcgcaagcgcag
gtccggcggcaagatgcccaggctgtcctggaggcgcggccccaggcggcggtgctggtt
cggaattggaaccagatcacccaagccttcgatgttcggcatgtggcccgccggagtgcc
cataaagctcgccagcaggctggtgtggttgatgccgaggtgcagaagctgcgggccgcc
ctcagcgagtcggagaagcaggatgttgctgaccaggcgacgcggaccagcctgcatcgc
gacatcttggaccatcaggagcgcctcacgcggttagctcccgaggtcactgcccgccga
gtcgaagccttgggcgaccaactgactgttttgggcgacctgaagcgcacgtcagaagac
tacgacagggctcaaacgcaggcccaaacggctcagacatccctagcggcagccgaggcg
gacagagatgccgcagcgaagcaggtccaggacgcagagcggggcattggagaggccgaa
gctgaggtcaaagcgctgatggcgccgactgatcgtgcattggctgctgtctcggatagc
gcgcagcatcttaggaagggattggtgccaggacagccttgtccggtttgtggcgccaag
gagcatcccattcatgccgacgcggtattggccgagttggctcgtgaccttcaggctgac
cttgatgcggctcgggagcgtgctgagaaaagtcggcatctccttacgagggcccagggg
aaggtcgcgcaggcggaagccgcggccaagcagttgcggaccaacattcaagaggccggg
gacagggctgaggccgccgagcgcttgtatggcgagacccttcccaaggcggagcggtct
gaccttcccgccggaccggcaggtgctgtgaccgccatacttgagctgggccgccaggtt
gccgaggagcggcgaactctccaggcccagcttgggcaggcggacgaattgcgtcaggcg
atcacccgcctgaccaccgagcgagatcggctgacggacgcgcttgaacaacggcaggga
acgcggcaacgcctttccgatgaggcgaacgccaaagggcagtcctatgcgctccatatg
caggctgctgctacggctgaggaacgcgtcgagaccatcgatgctggcctcgcctcggcg
ctggaggctggggacctgacccaggccgacctggagacggatgcggacgaggtgcgtcgg
gttctggccgagttggtgactgaacgagaaaatgctgaggccgaggctcttgtggcggac
gatgccttggcggcgctcgccccgcgtatcagcgggatacaggcgcgtgctgatgaactg
ctccgcggcgtcgaaaaattgaaggcggctgccgacgcgcgggcggaggaactgaaccgg
ttgcggggtgaacgggcggcgcttctcggcggcgaggccacggatgttcaccggacgcgg
atcaatgacgcccgggtggcggctattgcggccagggatgaggggcagcagaaggttcag
gctgcggagtcgacggtagccacggccaagcaagcgctgtcgggggcgacaacggctttg
gccgagtgccaggctgagcaggtggaggccaatggcgtcctggacgagactttggttagc
ggtgggctgaccgccgccgagctttccgagatcctatcccggccgcgagctgaggtggag
gcgctgcggacccgtttggcggcactggctgaccggcggacgagtgcgcacgcggcgctg
cgcgagcgtcagggtgacttggccactgcggaggtcgccggtgttccggagctgacgcta
gaggatctgcagcagcaaatttccggcatcgacaatgaactgtcagcccggcaagagcga
gtcggggccattcgtggtcggatgcagaccgatgttcaggccaggcggaacttggctggg
cttgaggccgagatcgcggaggcgcgggccacgttcgatgtctggcaggccgtcaacagc
gctgtgggttccaagaacggtgaccggttcgtccagcacgcccagtcgatcacgttggac
atcctggtcgaccgggcgaaccaccatctcgcggacttgaagccccgctaccggctggtt
cgtgcgggccaggacctggcgatgcatgtcgtggaccgggacatgggggacgaggtccgg
tcggtccgcagtttgtctggtggcgagcgcttcctggtttccttggccttggctttggcg
ctttcccggatgggtgggcacggtgggctggcggccacgctcttcatcgacgagggcttt
ggttcgcttgatgccgagagcctggacttggccatcgatgcgctggaggcgttgcagagc
caggggcgcaccgtgggcgtcatcagccacgtcgagatgatgaaggaccggatccccgtg
caggtgaatgtgacgcgaacgggtggcggcaagagccgcgtgtccatcaaaggggcaaac
tgggcccaaggtgcgtga

DBGET integrated database retrieval system