Nitrospirillum viridazoti: Y958_20685
Help
Entry
Y958_20685 CDS
T04935
Name
(GenBank) hypothetical protein
KO
K03546
DNA repair protein SbcC/Rad50
Organism
nao
Nitrospirillum viridazoti
Brite
KEGG Orthology (KO) [BR:
nao00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
nao03400
]
Y958_20685
DNA repair and recombination proteins [BR:
nao03400
]
Prokaryotic type
DSBR (double strand breaks repair)
HR (homologous recombination)
RecBC pathway proteins
Y958_20685
Archaeal homologous recombinant proteins
Y958_20685
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AAA_23
SbcC_Walker_B
SMC_N
AAA_29
ABC_tran
CLZ
Cgr1
AAA_15
AAA_21
nSTAND3
Motif
Other DBs
NCBI-ProteinID:
ASG23250
UniProt:
A0A248JXH7
LinkDB
All DBs
Position
2:complement(1685161..1688898)
Genome browser
AA seq
1245 aa
AA seq
DB search
MQILAIRGQNIASLADKFEIDFTAEPLKSAGLFAITGKTGAGKSSILDALCLALYGDCPR
FGLTGGNEDVPDAGGEAIKARDARGVLRRGASQGHAMVDFVGLDGEAYRATWIARRARGR
VDGRLQNIERSVQRLSDGQVLDSQTRAVEAKVPALTGLTYDEFRRTVLLAQGDFDAFLRA
DTKDRGALLEKVTGTEIYRDISIRVFERYSKAKADHDLLVARRAEHQLLSEEQRTALDDE
EKALLAAIEAARAGRQVLEADVGRHKALAEAQRRHEEAVRVAADADAALVEAAGDRADLE
RIDQAEPLRLPWARARTAAASVTKAAGEVSRAQVTLEQVTQQAVARRQEQDLAQAAVNEA
ERVFKEFGPIWSKATDLDSRIVRAGQEVADAAKAAAASGEEHSKALVQLRDLIAERAQAQ
VRRQDAQAVLEARPQAAVLVRNWNQITQAFDVRHVARRSAHKARQQAGVVDAEVQKLRAA
LSESEKQDVADQATRTSLHRDILDHQERLTRLAPEVTARRVEALGDQLTVLGDLKRTSED
YDRAQTQAQTAQTSLAAAEADRDAAAKQVQDAERGIGEAEAEVKALMAPTDRALAAVSDS
AQHLRKGLVPGQPCPVCGAKEHPIHADAVLAELARDLQADLDAARERAEKSRHLLTRAQG
KVAQAEAAAKQLRTNIQEAGDRAEAAERLYGETLPKAERSDLPAGPAGAVTAILELGRQV
AEERRTLQAQLGQADELRQAITRLTTERDRLTDALEQRQGTRQRLSDEANAKGQSYALHM
QAAATAEERVETIDAGLASALEAGDLTQADLETDADEVRRVLAELVTERENAEAEALVAD
DALAALAPRISGIQARADELLRGVEKLKAAADARAEELNRLRGERAALLGGEATDVHRTR
INDARVAAIAARDEGQQKVQAAESTVATAKQALSGATTALAECQAEQVEANGVLDETLVS
GGLTAAELSEILSRPRAEVEALRTRLAALADRRTSAHAALRERQGDLATAEVAGVPELTL
EDLQQQISGIDNELSARQERVGAIRGRMQTDVQARRNLAGLEAEIAEARATFDVWQAVNS
AVGSKNGDRFVQHAQSITLDILVDRANHHLADLKPRYRLVRAGQDLAMHVVDRDMGDEVR
SVRSLSGGERFLVSLALALALSRMGGHGGLAATLFIDEGFGSLDAESLDLAIDALEALQS
QGRTVGVISHVEMMKDRIPVQVNVTRTGGGKSRVSIKGANWAQGA
NT seq
3738 nt
NT seq
+upstream
nt +downstream
nt
atgcagatcctcgccattcggggccagaacatcgccagcttggccgacaagttcgagatc
gatttcaccgctgagccactgaagtcggcgggcctgttcgccatcacgggtaaaacggga
gcgggcaagtcatccatcctggatgccctttgcctcgcgctctacggggattgtccgcgc
tttggcctgacgggtggcaatgaggatgtgcccgacgccggtggcgaggcgatcaaggct
cgtgatgcgcgcggggtcctgcgaagaggggcgtcgcaaggccatgccatggtggatttc
gtcggactcgacggcgaagcctaccgggccacctggatcgcccggcgggcgcgagggcgg
gtggatgggcgtttacagaacatcgagcgcagcgttcagcgcctatccgatggccaggtg
ctggatagtcagacgagagctgttgaggcgaaggttcccgcgctgacggggctcacgtac
gacgagttccgccgcacggtgctgttggcccagggagacttcgatgccttcctccgtgct
gacaccaaggaccgtggtgccctgcttgagaaggtgacgggcacggagatctaccgcgac
atatcgattcgcgttttcgagcgatacagcaaggcgaaggctgatcacgacctgttggtg
gctcgccgagctgagcaccagcttctgtcggaagagcaacgcacggcccttgacgacgaa
gagaaggctttgctggcggccattgaggcagcgcgagccggacgccaggtcctggaggcc
gatgtcggtcgccataaggccttggcagaagctcagcggcggcatgaagaggctgttcgg
gtcgcggccgatgcggacgccgctctcgtggaggcagcgggagatcgtgccgacctggag
cgaattgaccaggctgaaccgctccgtcttccgtgggcccgagccaggacagcggcagcc
agcgtgaccaaggcggcgggagaggtttcgcgagcgcaggtcaccttggagcaagtcacc
cagcaggctgttgcccgccgacaagagcaggacctagcgcaggctgccgtgaacgaggcc
gagcgggttttcaaggaattcggtcctatctggtccaaggccacggacctcgacagccgc
atcgtccgcgctggccaggaggtcgccgatgctgcgaaagcggccgcggcgtcgggggaa
gagcactccaaggctctggtgcagttgcgcgacctgattgccgaaagggcgcaagcgcag
gtccggcggcaagatgcccaggctgtcctggaggcgcggccccaggcggcggtgctggtt
cggaattggaaccagatcacccaagccttcgatgttcggcatgtggcccgccggagtgcc
cataaagctcgccagcaggctggtgtggttgatgccgaggtgcagaagctgcgggccgcc
ctcagcgagtcggagaagcaggatgttgctgaccaggcgacgcggaccagcctgcatcgc
gacatcttggaccatcaggagcgcctcacgcggttagctcccgaggtcactgcccgccga
gtcgaagccttgggcgaccaactgactgttttgggcgacctgaagcgcacgtcagaagac
tacgacagggctcaaacgcaggcccaaacggctcagacatccctagcggcagccgaggcg
gacagagatgccgcagcgaagcaggtccaggacgcagagcggggcattggagaggccgaa
gctgaggtcaaagcgctgatggcgccgactgatcgtgcattggctgctgtctcggatagc
gcgcagcatcttaggaagggattggtgccaggacagccttgtccggtttgtggcgccaag
gagcatcccattcatgccgacgcggtattggccgagttggctcgtgaccttcaggctgac
cttgatgcggctcgggagcgtgctgagaaaagtcggcatctccttacgagggcccagggg
aaggtcgcgcaggcggaagccgcggccaagcagttgcggaccaacattcaagaggccggg
gacagggctgaggccgccgagcgcttgtatggcgagacccttcccaaggcggagcggtct
gaccttcccgccggaccggcaggtgctgtgaccgccatacttgagctgggccgccaggtt
gccgaggagcggcgaactctccaggcccagcttgggcaggcggacgaattgcgtcaggcg
atcacccgcctgaccaccgagcgagatcggctgacggacgcgcttgaacaacggcaggga
acgcggcaacgcctttccgatgaggcgaacgccaaagggcagtcctatgcgctccatatg
caggctgctgctacggctgaggaacgcgtcgagaccatcgatgctggcctcgcctcggcg
ctggaggctggggacctgacccaggccgacctggagacggatgcggacgaggtgcgtcgg
gttctggccgagttggtgactgaacgagaaaatgctgaggccgaggctcttgtggcggac
gatgccttggcggcgctcgccccgcgtatcagcgggatacaggcgcgtgctgatgaactg
ctccgcggcgtcgaaaaattgaaggcggctgccgacgcgcgggcggaggaactgaaccgg
ttgcggggtgaacgggcggcgcttctcggcggcgaggccacggatgttcaccggacgcgg
atcaatgacgcccgggtggcggctattgcggccagggatgaggggcagcagaaggttcag
gctgcggagtcgacggtagccacggccaagcaagcgctgtcgggggcgacaacggctttg
gccgagtgccaggctgagcaggtggaggccaatggcgtcctggacgagactttggttagc
ggtgggctgaccgccgccgagctttccgagatcctatcccggccgcgagctgaggtggag
gcgctgcggacccgtttggcggcactggctgaccggcggacgagtgcgcacgcggcgctg
cgcgagcgtcagggtgacttggccactgcggaggtcgccggtgttccggagctgacgcta
gaggatctgcagcagcaaatttccggcatcgacaatgaactgtcagcccggcaagagcga
gtcggggccattcgtggtcggatgcagaccgatgttcaggccaggcggaacttggctggg
cttgaggccgagatcgcggaggcgcgggccacgttcgatgtctggcaggccgtcaacagc
gctgtgggttccaagaacggtgaccggttcgtccagcacgcccagtcgatcacgttggac
atcctggtcgaccgggcgaaccaccatctcgcggacttgaagccccgctaccggctggtt
cgtgcgggccaggacctggcgatgcatgtcgtggaccgggacatgggggacgaggtccgg
tcggtccgcagtttgtctggtggcgagcgcttcctggtttccttggccttggctttggcg
ctttcccggatgggtgggcacggtgggctggcggccacgctcttcatcgacgagggcttt
ggttcgcttgatgccgagagcctggacttggccatcgatgcgctggaggcgttgcagagc
caggggcgcaccgtgggcgtcatcagccacgtcgagatgatgaaggaccggatccccgtg
caggtgaatgtgacgcgaacgggtggcggcaagagccgcgtgtccatcaaaggggcaaac
tgggcccaaggtgcgtga
DBGET
integrated database retrieval system