Nitrospirillum viridazoti: Y958_21880 Help Entry Y958_21880        CDS       T04935                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism nao  Nitrospirillum viridazoti Pathway nao01100   Metabolic pathways nao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Y958_21880    00074 Mycolic acid biosynthesis     Y958_21880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Y958_21880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ASG23453 UniProt:  A0A248JXK7 LinkDB All DBs Position 2:complement(1965203..1965436) Genome browser AA seq 77 aa AA seqDB search MNRNEFLAALDEMLELDPGTLKGGETLDEIDSWDSLAVISFIALVDEKFNTVVAGEDLAK AKTVDDLLALVSDHVTA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaaccggaacgaattcctggcggcgctggatgagatgctggagctggaccccggcacc ctgaagggcggcgaaacgctggatgagatcgacagctgggacagcctggcggtcatcagc ttcatcgccctggtggatgagaagttcaacaccgtggtggcgggcgaggatctggccaag gccaagaccgtggacgacctgctggccctggtgtcggaccacgtcacggcctga

DBGET integrated database retrieval system