Nitrospirillum viridazoti: Y958_26725 Help Entry Y958_26725        CDS       T04935                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nao  Nitrospirillum viridazoti Pathway nao01100   Metabolic pathways nao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Y958_26725    00074 Mycolic acid biosynthesis     Y958_26725   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Y958_26725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASG24469 UniProt:  A0A248K0Z5 LinkDB All DBs Position 3:1179917..1180168 Genome browser AA seq 83 aa AA seqDB search MQNSAEQIRSLVFDALRAALDRPVEFSDDTNITEGLGLDSVAVMDFVMEIEDALDISIPL DRIAEVKTVGDLVAAAQDLKGGR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcagaactccgcagagcagatccggtcgcttgtcttcgacgccctccgtgccgcgctg gataggcccgtcgaattttcggatgatacgaacatcaccgaaggcctcggtctggattcg gttgcagtcatggatttcgtgatggagatcgaggatgcgctcgacatctccatcccgctg gatcggatcgccgaggtgaagaccgtcggcgacctcgtcgccgcggcgcaggaccttaag ggcggccgctga

DBGET integrated database retrieval system