Nautilia sp. PV-1: C3L23_01495 Help Entry C3L23_01495       CDS       T05986                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nap  Nautilia sp. PV-1 Pathway nap01100   Metabolic pathways nap01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nap00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C3L23_01495 (acpP)    00074 Mycolic acid biosynthesis     C3L23_01495 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C3L23_01495 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 Motif Other DBs NCBI-ProteinID:  AZV45988 UniProt:  A0A3T0L077 LinkDB All DBs Position 264978..265211 Genome browser AA seq 77 aa AA seqDB search MALFDEVKEVIVEQLNVAPEEVKPEAKFVEDLGADSLDVVEMIMALEEKFEIEIPDSEAE KIQTVQDVIDFIEKAKS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcactatttgatgaagtaaaagaagttatagttgagcagctaaacgttgcacctgaa gaagtaaaaccggaagctaaattcgtagaagatcttggagctgacagtcttgacgtagtt gaaatgattatggcgcttgaagaaaaattcgaaatcgaaattcctgacagcgaagcggaa aaaatccagactgttcaagacgttatcgattttatcgaaaaagctaagtcttaa

DBGET integrated database retrieval system