Neisseria animalis: D0T90_03760 Help Entry D0T90_03760       CDS       T06425                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism naq  Neisseria animalis Pathway naq01100   Metabolic pathways naq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:naq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D0T90_03760    00074 Mycolic acid biosynthesis     D0T90_03760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D0T90_03760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 HLH DUF1493 Motif Other DBs NCBI-ProteinID:  QEY23730 UniProt:  A0A5P3MQL6 LinkDB All DBs Position complement(792397..792633) Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVDEAEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEDA EKITTVQLAIDYINAHNG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaacatcgaacaacaagttaaaaaaattgttgctgaacaactgggcgtagatgaa gccgaagtgaaaaacgagtcctctttccaagacgacttgggcgcggattctttggatacc gttgagctggtaatggctttggaagaagcattcggttgcgaaatccctgatgaagatgcc gaaaaaatcactaccgtacaactggctatcgattacatcaacgcccacaacggctaa

DBGET integrated database retrieval system