Neisseria animalis: D0T90_09915 Help Entry D0T90_09915       CDS       T06425                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism naq  Neisseria animalis Brite KEGG Orthology (KO) [BR:naq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:naq03036]     D0T90_09915 (ftsB) Chromosome and associated proteins [BR:naq03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     D0T90_09915 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Motif Other DBs NCBI-ProteinID:  QEY24737 UniProt:  A0A5P3MT02 LinkDB All DBs Position complement(2051747..2052025) Genome browser AA seq 92 aa AA seqDB search MKWVTVVLSIAIVYFQYSLWFGKGSVGHTKELQEQLILQTEKNQTLVLRNNFLAAEVNDL ANGQEAISEIARVELGYVQEGETYYRFVEHKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagtgggtaactgttgttttatcgattgctatcgtgtatttccaatatagcctttgg tttggtaaaggcagtgtagggcatacgaaagaattgcaagagcaactcatattgcagacc gaaaaaaaccaaacgcttgttttgcgaaataattttctggcggcagaagtaaacgacttg gcaaacgggcaagaggccatttcagaaattgcccgggtggaattaggttatgttcaagaa ggcgagacgtattaccgctttgtcgaacataagcgttga

DBGET integrated database retrieval system