Novosphingobium aromaticivorans: Saro_1339 Help Entry Saro_1339         CDS       T00322                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nar  Novosphingobium aromaticivorans Pathway nar01100   Metabolic pathways nar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Saro_1339    00074 Mycolic acid biosynthesis     Saro_1339   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Saro_1339 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  ABD25783 UniProt:  Q2G8P0 LinkDB All DBs Position 1381048..1381284 Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKISTVSDAIKYIDENKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgccgaccgcgttaagaagatcgttgtcgagcacctcggcgtcgaggct gacaaggtcaccgaagaagccagcttcatcgacgatctgggcgctgactcgctcgacatc gtcgagctggtcatggccttcgaagaagaatttggcgtcgagatccccgacgatgcggcc gagaagatctcgaccgtttcggacgcgatcaagtacatcgacgaaaacaagggctga

DBGET integrated database retrieval system