Novosphingobium aromaticivorans: Saro_2340 Help Entry Saro_2340         CDS       T00322                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism nar  Novosphingobium aromaticivorans Pathway nar01100   Metabolic pathways nar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Saro_2340    00074 Mycolic acid biosynthesis     Saro_2340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Saro_2340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABD26777 UniProt:  Q2G5U6 LinkDB All DBs Position 2488259..2488516 Genome browser AA seq 85 aa AA seqDB search MTDTDSTLRDILKDVLGLSAERVAAFDASTGLFGDLPELDSMAVAGLLTEIEDRLDIVIE DDEVDGELLETYGNLLAFLDSKVAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccgacaccgacagcaccctgcgcgatatcctgaaagacgtgcttggcctttcggca gaacgcgtcgccgcgttcgatgcctccaccggcctgttcggagatctgcccgagctggat tcgatggcggtcgccggcctgctgaccgagatcgaggaccgcctcgacatcgtgatcgag gacgacgaggtcgatggcgaattgctcgaaacctatggcaacctgctggccttcctggat tccaaagtcgccgcgtga

DBGET integrated database retrieval system