Novosphingobium aromaticivorans: Saro_3110 Help Entry Saro_3110         CDS       T00322                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism nar  Novosphingobium aromaticivorans Pathway nar01100   Metabolic pathways nar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Saro_3110    00074 Mycolic acid biosynthesis     Saro_3110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Saro_3110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 SPATA9 Motif Other DBs NCBI-ProteinID:  ABD27545 UniProt:  Q2G3M8 LinkDB All DBs Position 3325240..3325479 Genome browser AA seq 79 aa AA seqDB search MDRAATAEKIAELIAPFNKKGVAITDATTFAGDLEWDSLTVMDFVAEIEDEFDIIISMNQ QAEIENYGQLVDAVTKLQG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaccgcgccgcaaccgccgagaagatcgcagaactgatcgcccccttcaacaagaag ggcgtcgcgatcaccgacgcgaccaccttcgccggcgacctcgagtgggacagcctgacg gtgatggacttcgtcgccgagatcgaggacgaattcgacatcatcatcagcatgaaccag caggccgagatcgagaactatggccagctcgtcgatgcggtgacgaagctgcagggataa

DBGET integrated database retrieval system