Natronorubrum aibiense: GCU68_02520 Help Entry GCU68_02520       CDS       T06256                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nas  Natronorubrum aibiense Pathway nas03010   Ribosome Brite KEGG Orthology (KO) [BR:nas00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     GCU68_02520   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     GCU68_02520  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nas03011]     GCU68_02520    04121 Ubiquitin system [BR:nas04121]     GCU68_02520   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nas04147]     GCU68_02520 Ribosome [BR:nas03011]  Ribosomal proteins   Eukaryotes    Small subunit     GCU68_02520   Archaea     GCU68_02520 Ubiquitin system [BR:nas04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    GCU68_02520 Exosome [BR:nas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GCU68_02520   Exosomal proteins of colorectal cancer cells    GCU68_02520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 Zn_ribbon_Nudix FYVE Ribosomal_L37e Cas12f1-like_TNB Zn_Ribbon_TF Zn_ribbon_3 Zn_ribbon_RPAB4 KduI zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  QFU81514 UniProt:  A0A5P9P050 LinkDB All DBs Position complement(497335..497469) Genome browser AA seq 44 aa AA seqDB search MARHELYNDDGTTDREMCPRCGDVFLADHGDRTHCGKCGYTEWA NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcacgccacgaactctacaacgacgacggtaccaccgaccgcgaaatgtgtccccgc tgtggcgacgtgttcctcgcagaccacggcgaccgcacccactgtggcaagtgcggctac accgagtgggcgtaa

DBGET integrated database retrieval system