KEGG   Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise): 112399896
Entry
112399896         CDS       T08872                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
nasi  Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)
Pathway
nasi04010  MAPK signaling pathway
nasi04014  Ras signaling pathway
nasi04015  Rap1 signaling pathway
nasi04024  cAMP signaling pathway
nasi04062  Chemokine signaling pathway
nasi04071  Sphingolipid signaling pathway
nasi04145  Phagosome
nasi04148  Efferocytosis
nasi04151  PI3K-Akt signaling pathway
nasi04310  Wnt signaling pathway
nasi04360  Axon guidance
nasi04370  VEGF signaling pathway
nasi04380  Osteoclast differentiation
nasi04510  Focal adhesion
nasi04520  Adherens junction
nasi04530  Tight junction
nasi04613  Neutrophil extracellular trap formation
nasi04620  Toll-like receptor signaling pathway
nasi04650  Natural killer cell mediated cytotoxicity
nasi04662  B cell receptor signaling pathway
nasi04664  Fc epsilon RI signaling pathway
nasi04666  Fc gamma R-mediated phagocytosis
nasi04670  Leukocyte transendothelial migration
nasi04722  Neurotrophin signaling pathway
nasi04810  Regulation of actin cytoskeleton
nasi04932  Non-alcoholic fatty liver disease
nasi04933  AGE-RAGE signaling pathway in diabetic complications
nasi04972  Pancreatic secretion
nasi05014  Amyotrophic lateral sclerosis
nasi05020  Prion disease
nasi05022  Pathways of neurodegeneration - multiple diseases
nasi05100  Bacterial invasion of epithelial cells
nasi05132  Salmonella infection
nasi05135  Yersinia infection
nasi05163  Human cytomegalovirus infection
nasi05167  Kaposi sarcoma-associated herpesvirus infection
nasi05169  Epstein-Barr virus infection
nasi05170  Human immunodeficiency virus 1 infection
nasi05200  Pathways in cancer
nasi05203  Viral carcinogenesis
nasi05205  Proteoglycans in cancer
nasi05208  Chemical carcinogenesis - reactive oxygen species
nasi05210  Colorectal cancer
nasi05211  Renal cell carcinoma
nasi05212  Pancreatic cancer
nasi05231  Choline metabolism in cancer
nasi05415  Diabetic cardiomyopathy
nasi05416  Viral myocarditis
nasi05417  Lipid and atherosclerosis
nasi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nasi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112399896 (RAC1)
   04014 Ras signaling pathway
    112399896 (RAC1)
   04015 Rap1 signaling pathway
    112399896 (RAC1)
   04310 Wnt signaling pathway
    112399896 (RAC1)
   04370 VEGF signaling pathway
    112399896 (RAC1)
   04071 Sphingolipid signaling pathway
    112399896 (RAC1)
   04024 cAMP signaling pathway
    112399896 (RAC1)
   04151 PI3K-Akt signaling pathway
    112399896 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112399896 (RAC1)
   04148 Efferocytosis
    112399896 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112399896 (RAC1)
   04520 Adherens junction
    112399896 (RAC1)
   04530 Tight junction
    112399896 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112399896 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112399896 (RAC1)
   04620 Toll-like receptor signaling pathway
    112399896 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    112399896 (RAC1)
   04662 B cell receptor signaling pathway
    112399896 (RAC1)
   04664 Fc epsilon RI signaling pathway
    112399896 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    112399896 (RAC1)
   04670 Leukocyte transendothelial migration
    112399896 (RAC1)
   04062 Chemokine signaling pathway
    112399896 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    112399896 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112399896 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    112399896 (RAC1)
   04380 Osteoclast differentiation
    112399896 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112399896 (RAC1)
   05205 Proteoglycans in cancer
    112399896 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    112399896 (RAC1)
   05203 Viral carcinogenesis
    112399896 (RAC1)
   05231 Choline metabolism in cancer
    112399896 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112399896 (RAC1)
   05212 Pancreatic cancer
    112399896 (RAC1)
   05211 Renal cell carcinoma
    112399896 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112399896 (RAC1)
   05163 Human cytomegalovirus infection
    112399896 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112399896 (RAC1)
   05169 Epstein-Barr virus infection
    112399896 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112399896 (RAC1)
   05135 Yersinia infection
    112399896 (RAC1)
   05100 Bacterial invasion of epithelial cells
    112399896 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    112399896 (RAC1)
   05020 Prion disease
    112399896 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    112399896 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    112399896 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    112399896 (RAC1)
   05415 Diabetic cardiomyopathy
    112399896 (RAC1)
   05416 Viral myocarditis
    112399896 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112399896 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112399896 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nasi04131]
    112399896 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nasi04147]
    112399896 (RAC1)
   04031 GTP-binding proteins [BR:nasi04031]
    112399896 (RAC1)
Membrane trafficking [BR:nasi04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112399896 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    112399896 (RAC1)
  Macropinocytosis
   Ras GTPases
    112399896 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    112399896 (RAC1)
Exosome [BR:nasi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112399896 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   112399896 (RAC1)
  Exosomal proteins of colorectal cancer cells
   112399896 (RAC1)
  Exosomal proteins of bladder cancer cells
   112399896 (RAC1)
GTP-binding proteins [BR:nasi04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112399896 (RAC1)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU CagD Arf
Other DBs
NCBI-GeneID: 112399896
NCBI-ProteinID: XP_024601084
UniProt: A0A341BFQ6
LinkDB
Position
Unknown
AA seq 148 aa
MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHH
CPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRG
LKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 447 nt   +upstreamnt  +downstreamnt
atggtggatggaaaaccggtgaatctgggcttgtgggatacagctggacaagaagattat
gaccgattacgtcccctatcctatcctcaaacggatgtattcttgatttgcttttctctt
gtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtaccctgaagtgcgacaccac
tgtcccaacactcctatcatcctggtggggacgaaacttgatctgagggatgataaagac
acgattgagaaactgaaggagaagaagctgacacccatcacctacccgcagggcttggcc
atggccaaggagatcggtgccgtcaaatacctggagtgctcggcgctcacgcagcgaggt
cttaagacggtgtttgatgaagctatccgggcggttctctgcccaccccccgtcaagaag
aggaagagaaaatgcctgctgttgtga

DBGET integrated database retrieval system