KEGG   Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise): 112412232
Entry
112412232         CDS       T08872                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
nasi  Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)
Pathway
nasi01521  EGFR tyrosine kinase inhibitor resistance
nasi01522  Endocrine resistance
nasi01524  Platinum drug resistance
nasi04010  MAPK signaling pathway
nasi04012  ErbB signaling pathway
nasi04014  Ras signaling pathway
nasi04015  Rap1 signaling pathway
nasi04022  cGMP-PKG signaling pathway
nasi04024  cAMP signaling pathway
nasi04062  Chemokine signaling pathway
nasi04066  HIF-1 signaling pathway
nasi04068  FoxO signaling pathway
nasi04071  Sphingolipid signaling pathway
nasi04072  Phospholipase D signaling pathway
nasi04114  Oocyte meiosis
nasi04140  Autophagy - animal
nasi04148  Efferocytosis
nasi04150  mTOR signaling pathway
nasi04151  PI3K-Akt signaling pathway
nasi04210  Apoptosis
nasi04218  Cellular senescence
nasi04261  Adrenergic signaling in cardiomyocytes
nasi04270  Vascular smooth muscle contraction
nasi04350  TGF-beta signaling pathway
nasi04360  Axon guidance
nasi04370  VEGF signaling pathway
nasi04371  Apelin signaling pathway
nasi04380  Osteoclast differentiation
nasi04510  Focal adhesion
nasi04517  IgSF CAM signaling
nasi04520  Adherens junction
nasi04540  Gap junction
nasi04550  Signaling pathways regulating pluripotency of stem cells
nasi04611  Platelet activation
nasi04613  Neutrophil extracellular trap formation
nasi04620  Toll-like receptor signaling pathway
nasi04621  NOD-like receptor signaling pathway
nasi04625  C-type lectin receptor signaling pathway
nasi04650  Natural killer cell mediated cytotoxicity
nasi04657  IL-17 signaling pathway
nasi04658  Th1 and Th2 cell differentiation
nasi04659  Th17 cell differentiation
nasi04660  T cell receptor signaling pathway
nasi04662  B cell receptor signaling pathway
nasi04664  Fc epsilon RI signaling pathway
nasi04666  Fc gamma R-mediated phagocytosis
nasi04668  TNF signaling pathway
nasi04713  Circadian entrainment
nasi04720  Long-term potentiation
nasi04722  Neurotrophin signaling pathway
nasi04723  Retrograde endocannabinoid signaling
nasi04724  Glutamatergic synapse
nasi04725  Cholinergic synapse
nasi04726  Serotonergic synapse
nasi04730  Long-term depression
nasi04810  Regulation of actin cytoskeleton
nasi04910  Insulin signaling pathway
nasi04912  GnRH signaling pathway
nasi04914  Progesterone-mediated oocyte maturation
nasi04915  Estrogen signaling pathway
nasi04916  Melanogenesis
nasi04917  Prolactin signaling pathway
nasi04919  Thyroid hormone signaling pathway
nasi04921  Oxytocin signaling pathway
nasi04926  Relaxin signaling pathway
nasi04928  Parathyroid hormone synthesis, secretion and action
nasi04929  GnRH secretion
nasi04930  Type II diabetes mellitus
nasi04933  AGE-RAGE signaling pathway in diabetic complications
nasi04934  Cushing syndrome
nasi04935  Growth hormone synthesis, secretion and action
nasi04960  Aldosterone-regulated sodium reabsorption
nasi05010  Alzheimer disease
nasi05020  Prion disease
nasi05022  Pathways of neurodegeneration - multiple diseases
nasi05034  Alcoholism
nasi05132  Salmonella infection
nasi05133  Pertussis
nasi05135  Yersinia infection
nasi05140  Leishmaniasis
nasi05142  Chagas disease
nasi05145  Toxoplasmosis
nasi05152  Tuberculosis
nasi05160  Hepatitis C
nasi05161  Hepatitis B
nasi05163  Human cytomegalovirus infection
nasi05164  Influenza A
nasi05165  Human papillomavirus infection
nasi05166  Human T-cell leukemia virus 1 infection
nasi05167  Kaposi sarcoma-associated herpesvirus infection
nasi05170  Human immunodeficiency virus 1 infection
nasi05171  Coronavirus disease - COVID-19
nasi05200  Pathways in cancer
nasi05203  Viral carcinogenesis
nasi05205  Proteoglycans in cancer
nasi05206  MicroRNAs in cancer
nasi05207  Chemical carcinogenesis - receptor activation
nasi05208  Chemical carcinogenesis - reactive oxygen species
nasi05210  Colorectal cancer
nasi05211  Renal cell carcinoma
nasi05212  Pancreatic cancer
nasi05213  Endometrial cancer
nasi05214  Glioma
nasi05215  Prostate cancer
nasi05216  Thyroid cancer
nasi05218  Melanoma
nasi05219  Bladder cancer
nasi05220  Chronic myeloid leukemia
nasi05221  Acute myeloid leukemia
nasi05223  Non-small cell lung cancer
nasi05224  Breast cancer
nasi05225  Hepatocellular carcinoma
nasi05226  Gastric cancer
nasi05230  Central carbon metabolism in cancer
nasi05231  Choline metabolism in cancer
nasi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nasi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nasi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112412232 (MAPK1)
   04012 ErbB signaling pathway
    112412232 (MAPK1)
   04014 Ras signaling pathway
    112412232 (MAPK1)
   04015 Rap1 signaling pathway
    112412232 (MAPK1)
   04350 TGF-beta signaling pathway
    112412232 (MAPK1)
   04370 VEGF signaling pathway
    112412232 (MAPK1)
   04371 Apelin signaling pathway
    112412232 (MAPK1)
   04668 TNF signaling pathway
    112412232 (MAPK1)
   04066 HIF-1 signaling pathway
    112412232 (MAPK1)
   04068 FoxO signaling pathway
    112412232 (MAPK1)
   04072 Phospholipase D signaling pathway
    112412232 (MAPK1)
   04071 Sphingolipid signaling pathway
    112412232 (MAPK1)
   04024 cAMP signaling pathway
    112412232 (MAPK1)
   04022 cGMP-PKG signaling pathway
    112412232 (MAPK1)
   04151 PI3K-Akt signaling pathway
    112412232 (MAPK1)
   04150 mTOR signaling pathway
    112412232 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    112412232 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112412232 (MAPK1)
   04148 Efferocytosis
    112412232 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112412232 (MAPK1)
   04210 Apoptosis
    112412232 (MAPK1)
   04218 Cellular senescence
    112412232 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112412232 (MAPK1)
   04520 Adherens junction
    112412232 (MAPK1)
   04540 Gap junction
    112412232 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112412232 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112412232 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112412232 (MAPK1)
   04613 Neutrophil extracellular trap formation
    112412232 (MAPK1)
   04620 Toll-like receptor signaling pathway
    112412232 (MAPK1)
   04621 NOD-like receptor signaling pathway
    112412232 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    112412232 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    112412232 (MAPK1)
   04660 T cell receptor signaling pathway
    112412232 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    112412232 (MAPK1)
   04659 Th17 cell differentiation
    112412232 (MAPK1)
   04657 IL-17 signaling pathway
    112412232 (MAPK1)
   04662 B cell receptor signaling pathway
    112412232 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    112412232 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    112412232 (MAPK1)
   04062 Chemokine signaling pathway
    112412232 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112412232 (MAPK1)
   04929 GnRH secretion
    112412232 (MAPK1)
   04912 GnRH signaling pathway
    112412232 (MAPK1)
   04915 Estrogen signaling pathway
    112412232 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    112412232 (MAPK1)
   04917 Prolactin signaling pathway
    112412232 (MAPK1)
   04921 Oxytocin signaling pathway
    112412232 (MAPK1)
   04926 Relaxin signaling pathway
    112412232 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    112412232 (MAPK1)
   04919 Thyroid hormone signaling pathway
    112412232 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    112412232 (MAPK1)
   04916 Melanogenesis
    112412232 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112412232 (MAPK1)
   04270 Vascular smooth muscle contraction
    112412232 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112412232 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    112412232 (MAPK1)
   04725 Cholinergic synapse
    112412232 (MAPK1)
   04726 Serotonergic synapse
    112412232 (MAPK1)
   04720 Long-term potentiation
    112412232 (MAPK1)
   04730 Long-term depression
    112412232 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    112412232 (MAPK1)
   04722 Neurotrophin signaling pathway
    112412232 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    112412232 (MAPK1)
   04380 Osteoclast differentiation
    112412232 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112412232 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112412232 (MAPK1)
   05206 MicroRNAs in cancer
    112412232 (MAPK1)
   05205 Proteoglycans in cancer
    112412232 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    112412232 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    112412232 (MAPK1)
   05203 Viral carcinogenesis
    112412232 (MAPK1)
   05230 Central carbon metabolism in cancer
    112412232 (MAPK1)
   05231 Choline metabolism in cancer
    112412232 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112412232 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112412232 (MAPK1)
   05212 Pancreatic cancer
    112412232 (MAPK1)
   05225 Hepatocellular carcinoma
    112412232 (MAPK1)
   05226 Gastric cancer
    112412232 (MAPK1)
   05214 Glioma
    112412232 (MAPK1)
   05216 Thyroid cancer
    112412232 (MAPK1)
   05221 Acute myeloid leukemia
    112412232 (MAPK1)
   05220 Chronic myeloid leukemia
    112412232 (MAPK1)
   05218 Melanoma
    112412232 (MAPK1)
   05211 Renal cell carcinoma
    112412232 (MAPK1)
   05219 Bladder cancer
    112412232 (MAPK1)
   05215 Prostate cancer
    112412232 (MAPK1)
   05213 Endometrial cancer
    112412232 (MAPK1)
   05224 Breast cancer
    112412232 (MAPK1)
   05223 Non-small cell lung cancer
    112412232 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112412232 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    112412232 (MAPK1)
   05161 Hepatitis B
    112412232 (MAPK1)
   05160 Hepatitis C
    112412232 (MAPK1)
   05171 Coronavirus disease - COVID-19
    112412232 (MAPK1)
   05164 Influenza A
    112412232 (MAPK1)
   05163 Human cytomegalovirus infection
    112412232 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112412232 (MAPK1)
   05165 Human papillomavirus infection
    112412232 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112412232 (MAPK1)
   05135 Yersinia infection
    112412232 (MAPK1)
   05133 Pertussis
    112412232 (MAPK1)
   05152 Tuberculosis
    112412232 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112412232 (MAPK1)
   05140 Leishmaniasis
    112412232 (MAPK1)
   05142 Chagas disease
    112412232 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112412232 (MAPK1)
   05020 Prion disease
    112412232 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    112412232 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    112412232 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    112412232 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112412232 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112412232 (MAPK1)
   04934 Cushing syndrome
    112412232 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112412232 (MAPK1)
   01524 Platinum drug resistance
    112412232 (MAPK1)
   01522 Endocrine resistance
    112412232 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nasi01001]
    112412232 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nasi03036]
    112412232 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nasi04147]
    112412232 (MAPK1)
Enzymes [BR:nasi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112412232 (MAPK1)
Protein kinases [BR:nasi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112412232 (MAPK1)
Chromosome and associated proteins [BR:nasi03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112412232 (MAPK1)
Exosome [BR:nasi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112412232 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 112412232
NCBI-ProteinID: XP_024619583
UniProt: A0A341CXW3
LinkDB
Position
Unknown
AA seq 343 aa
MSTYPEETRSNVLLPVRVLSLLRSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLR
FRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGL
KYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPE
IMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIIN
LKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYY
DPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgagcacttacccagaggagaccagaagtaatgtcttactgcccgtccgtgttctttca
ttgcttcgctctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagc
ccttttgagcaccagacctactgccagagaaccctgagggagataaaaatcttactgcgc
ttcagacatgagaacatcattggaatcaatgatattattcgagcaccaaccattgagcag
atgaaagatgtatatatagtacaggacctcatggaaacagatctctacaagctcttgaag
acgcaacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggtta
aaatatatccattcagctaacgtgctgcaccgtgacctcaaaccttccaacctgctgctc
aacaccacctgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggac
catgatcacacagggttcctgacggagtacgttgccacacgttggtacagggctccagaa
attatgttgaattccaagggctacaccaagtccattgatatttggtctgtaggctgcatc
ctggcagagatgctctccaacaggcccatcttcccggggaagcattacctcgaccagctg
aaccacattctgggtattcttggatccccatcccaggaagacctgaattgtataataaat
ttaaaagctaggaactatttgctttctcttccgcacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgactccaaagctctggatttactggacaagatgttgacgttcaac
cctcataagaggattgaggtggaacaggctctggcccacccgtacctggagcagtactac
gacccaagtgacgagcccatcgccgaagcaccattcaagtttgacatggaattggatgac
ttgcccaaggaaaagctcaaagaactcatttttgaagagaccgctagattccagccagga
tacagatcttaa

DBGET integrated database retrieval system