KEGG   Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise): 112413065
Entry
112413065         CDS       T08872                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
nasi  Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)
Pathway
nasi01521  EGFR tyrosine kinase inhibitor resistance
nasi01522  Endocrine resistance
nasi04010  MAPK signaling pathway
nasi04012  ErbB signaling pathway
nasi04014  Ras signaling pathway
nasi04015  Rap1 signaling pathway
nasi04062  Chemokine signaling pathway
nasi04068  FoxO signaling pathway
nasi04071  Sphingolipid signaling pathway
nasi04072  Phospholipase D signaling pathway
nasi04137  Mitophagy - animal
nasi04140  Autophagy - animal
nasi04150  mTOR signaling pathway
nasi04151  PI3K-Akt signaling pathway
nasi04210  Apoptosis
nasi04211  Longevity regulating pathway
nasi04213  Longevity regulating pathway - multiple species
nasi04218  Cellular senescence
nasi04360  Axon guidance
nasi04370  VEGF signaling pathway
nasi04371  Apelin signaling pathway
nasi04540  Gap junction
nasi04550  Signaling pathways regulating pluripotency of stem cells
nasi04625  C-type lectin receptor signaling pathway
nasi04650  Natural killer cell mediated cytotoxicity
nasi04660  T cell receptor signaling pathway
nasi04662  B cell receptor signaling pathway
nasi04664  Fc epsilon RI signaling pathway
nasi04714  Thermogenesis
nasi04720  Long-term potentiation
nasi04722  Neurotrophin signaling pathway
nasi04725  Cholinergic synapse
nasi04726  Serotonergic synapse
nasi04730  Long-term depression
nasi04810  Regulation of actin cytoskeleton
nasi04910  Insulin signaling pathway
nasi04912  GnRH signaling pathway
nasi04915  Estrogen signaling pathway
nasi04916  Melanogenesis
nasi04917  Prolactin signaling pathway
nasi04919  Thyroid hormone signaling pathway
nasi04921  Oxytocin signaling pathway
nasi04926  Relaxin signaling pathway
nasi04929  GnRH secretion
nasi04933  AGE-RAGE signaling pathway in diabetic complications
nasi04935  Growth hormone synthesis, secretion and action
nasi05010  Alzheimer disease
nasi05022  Pathways of neurodegeneration - multiple diseases
nasi05034  Alcoholism
nasi05160  Hepatitis C
nasi05161  Hepatitis B
nasi05163  Human cytomegalovirus infection
nasi05165  Human papillomavirus infection
nasi05166  Human T-cell leukemia virus 1 infection
nasi05167  Kaposi sarcoma-associated herpesvirus infection
nasi05170  Human immunodeficiency virus 1 infection
nasi05200  Pathways in cancer
nasi05203  Viral carcinogenesis
nasi05205  Proteoglycans in cancer
nasi05206  MicroRNAs in cancer
nasi05207  Chemical carcinogenesis - receptor activation
nasi05208  Chemical carcinogenesis - reactive oxygen species
nasi05210  Colorectal cancer
nasi05211  Renal cell carcinoma
nasi05213  Endometrial cancer
nasi05214  Glioma
nasi05215  Prostate cancer
nasi05216  Thyroid cancer
nasi05218  Melanoma
nasi05219  Bladder cancer
nasi05220  Chronic myeloid leukemia
nasi05221  Acute myeloid leukemia
nasi05223  Non-small cell lung cancer
nasi05224  Breast cancer
nasi05225  Hepatocellular carcinoma
nasi05226  Gastric cancer
nasi05230  Central carbon metabolism in cancer
nasi05231  Choline metabolism in cancer
nasi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nasi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nasi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112413065 (NRAS)
   04012 ErbB signaling pathway
    112413065 (NRAS)
   04014 Ras signaling pathway
    112413065 (NRAS)
   04015 Rap1 signaling pathway
    112413065 (NRAS)
   04370 VEGF signaling pathway
    112413065 (NRAS)
   04371 Apelin signaling pathway
    112413065 (NRAS)
   04068 FoxO signaling pathway
    112413065 (NRAS)
   04072 Phospholipase D signaling pathway
    112413065 (NRAS)
   04071 Sphingolipid signaling pathway
    112413065 (NRAS)
   04151 PI3K-Akt signaling pathway
    112413065 (NRAS)
   04150 mTOR signaling pathway
    112413065 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112413065 (NRAS)
   04137 Mitophagy - animal
    112413065 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    112413065 (NRAS)
   04218 Cellular senescence
    112413065 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112413065 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    112413065 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112413065 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112413065 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    112413065 (NRAS)
   04660 T cell receptor signaling pathway
    112413065 (NRAS)
   04662 B cell receptor signaling pathway
    112413065 (NRAS)
   04664 Fc epsilon RI signaling pathway
    112413065 (NRAS)
   04062 Chemokine signaling pathway
    112413065 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112413065 (NRAS)
   04929 GnRH secretion
    112413065 (NRAS)
   04912 GnRH signaling pathway
    112413065 (NRAS)
   04915 Estrogen signaling pathway
    112413065 (NRAS)
   04917 Prolactin signaling pathway
    112413065 (NRAS)
   04921 Oxytocin signaling pathway
    112413065 (NRAS)
   04926 Relaxin signaling pathway
    112413065 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    112413065 (NRAS)
   04919 Thyroid hormone signaling pathway
    112413065 (NRAS)
   04916 Melanogenesis
    112413065 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    112413065 (NRAS)
   04726 Serotonergic synapse
    112413065 (NRAS)
   04720 Long-term potentiation
    112413065 (NRAS)
   04730 Long-term depression
    112413065 (NRAS)
   04722 Neurotrophin signaling pathway
    112413065 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    112413065 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    112413065 (NRAS)
   04213 Longevity regulating pathway - multiple species
    112413065 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    112413065 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112413065 (NRAS)
   05206 MicroRNAs in cancer
    112413065 (NRAS)
   05205 Proteoglycans in cancer
    112413065 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    112413065 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    112413065 (NRAS)
   05203 Viral carcinogenesis
    112413065 (NRAS)
   05230 Central carbon metabolism in cancer
    112413065 (NRAS)
   05231 Choline metabolism in cancer
    112413065 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112413065 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112413065 (NRAS)
   05225 Hepatocellular carcinoma
    112413065 (NRAS)
   05226 Gastric cancer
    112413065 (NRAS)
   05214 Glioma
    112413065 (NRAS)
   05216 Thyroid cancer
    112413065 (NRAS)
   05221 Acute myeloid leukemia
    112413065 (NRAS)
   05220 Chronic myeloid leukemia
    112413065 (NRAS)
   05218 Melanoma
    112413065 (NRAS)
   05211 Renal cell carcinoma
    112413065 (NRAS)
   05219 Bladder cancer
    112413065 (NRAS)
   05215 Prostate cancer
    112413065 (NRAS)
   05213 Endometrial cancer
    112413065 (NRAS)
   05224 Breast cancer
    112413065 (NRAS)
   05223 Non-small cell lung cancer
    112413065 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112413065 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    112413065 (NRAS)
   05161 Hepatitis B
    112413065 (NRAS)
   05160 Hepatitis C
    112413065 (NRAS)
   05163 Human cytomegalovirus infection
    112413065 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112413065 (NRAS)
   05165 Human papillomavirus infection
    112413065 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112413065 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    112413065 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    112413065 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    112413065 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112413065 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112413065 (NRAS)
   01522 Endocrine resistance
    112413065 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nasi04131]
    112413065 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nasi04147]
    112413065 (NRAS)
   04031 GTP-binding proteins [BR:nasi04031]
    112413065 (NRAS)
Membrane trafficking [BR:nasi04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    112413065 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112413065 (NRAS)
Exosome [BR:nasi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112413065 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   112413065 (NRAS)
  Exosomal proteins of breast cancer cells
   112413065 (NRAS)
  Exosomal proteins of colorectal cancer cells
   112413065 (NRAS)
GTP-binding proteins [BR:nasi04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112413065 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 112413065
NCBI-ProteinID: XP_024620686
UniProt: A0A341D102
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattgccatgtgtagtgatgtaa

DBGET integrated database retrieval system