Nicotiana attenuata (coyote tobacco): 109206069 Help Entry 109206069         CDS       T05870                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism nau  Nicotiana attenuata (coyote tobacco) Pathway nau04016   MAPK signaling pathway - plant nau04070   Phosphatidylinositol signaling system nau04075   Plant hormone signal transduction nau04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:nau00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     109206069    04070 Phosphatidylinositol signaling system     109206069    04075 Plant hormone signal transduction     109206069  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     109206069  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nau01009]     109206069   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nau04131]     109206069    03036 Chromosome and associated proteins [BR:nau03036]     109206069   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nau04147]     109206069 Protein phosphatases and associated proteins [BR:nau01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109206069 Membrane trafficking [BR:nau04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109206069 Chromosome and associated proteins [BR:nau03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109206069 Exosome [BR:nau04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109206069 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg Dockerin_1 EH RNA_pol_Rpb4 TerB SPEF2_C EF-hand_11 EF_EFCAB10_C DUF5580_M PA_Ig-like FAD-depend_C Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  109206069 NCBI-ProteinID:  XP_019224382 UniProt:  A0A314KX82 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MADALSEDQISEFREAFWVIDKDCDGVIRMEELAAVIQSLNEHPTKEEIQEMVNEVDPDG DGTIDFEDFLNIMAKKLKDNVSEELKEAFKVFDRDQDGFISANELRNVMMNLGERLTDEE AQQMIREADLDGDGLVSYEEFVKIMII NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggctgatgcactgtcagaagaccaaatttctgagtttcgtgaagccttctgggttatc gacaaggattgtgatggggtgataagaatggaggaacttgcggcagtaatccaatcttta aatgaacatccaaccaaggaagagattcaagaaatggtaaatgaagtggatcctgatggt gatggcactattgattttgaagatttcttgaatatcatggctaaaaagctcaaggacaac gtatcagaggagcttaaagaagcatttaaagtatttgatcgagatcaagatggatttatt tctgctaatgagttaagaaatgtgatgatgaatttgggagaaagattgacagatgaagaa gcccaacagatgatcagagaggcagatcttgatggagatggtcttgttagctatgaggaa tttgttaagatcatgattatttga

DBGET integrated database retrieval system