Nicotiana attenuata (coyote tobacco): 109217021 Help Entry 109217021         CDS       T05870                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism nau  Nicotiana attenuata (coyote tobacco) Pathway nau03083   Polycomb repressive complex nau04120   Ubiquitin mediated proteolysis nau04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109217021    04120 Ubiquitin mediated proteolysis     109217021   09126 Chromosome    03083 Polycomb repressive complex     109217021  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nau04131]     109217021    04121 Ubiquitin system [BR:nau04121]     109217021    03036 Chromosome and associated proteins [BR:nau03036]     109217021 Membrane trafficking [BR:nau04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     109217021 Ubiquitin system [BR:nau04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      109217021    Cul7 complex      109217021 Chromosome and associated proteins [BR:nau03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      109217021   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      109217021 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  109217021 NCBI-ProteinID:  XP_019236793 UniProt:  A0A1J6JYM6 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MASTTEQKKMLILKSSNGDEFEIEESVAVQSITIKNMVEDNYTKIPLPNVDTQTLIKIIE YLMKHAVEKTYTNEEEIENFDKEFVNGKSYRDLFELILAANYLEIKGLLDLLCQSIADRI KNKSANAVRKIFNITPDYSTEEEEEEKVRID NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggcatcaacaactgagcaaaagaagatgttgatcttaaaatcctcgaatggcgacgaa tttgagatcgaagaatccgtcgccgttcaatcaataaccataaaaaacatggtggaggac aattacaccaaaatcccactcccaaatgtcgatactcaaaccctaatcaaaattatcgaa tacttgatgaaacacgccgttgagaagacgtatacgaacgaagaagaaatcgaaaatttc gacaaggaattcgtgaacgggaagagttacagagacctgtttgaacttatattggctgct aattaccttgaaattaagggtttgctcgatcttttgtgtcagtcgattgctgataggatt aagaacaaatcggcgaatgctgttaggaagatatttaatatcacgcccgattacagtact gaagaagaagaagaagaaaaggttagaattgattag

DBGET integrated database retrieval system