Nicotiana attenuata (coyote tobacco): 109218790 Help Entry 109218790         CDS       T05870                                  Name (RefSeq) histone H2B.2-like   KO K11252   histone H2B Organism nau  Nicotiana attenuata (coyote tobacco) Brite KEGG Orthology (KO) [BR:nau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nau03036]     109218790   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nau04147]     109218790 Chromosome and associated proteins [BR:nau03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109218790 Exosome [BR:nau04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109218790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  109218790 NCBI-ProteinID:  XP_019238719 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MKQVHPDMGISSKAMTILDNVMGDMFERIAQAAATLSTYVGRTTFSSREIQGAVKIVLPG ELGKHGIAEGTKAVVSYFTTVAEENKSKTK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaagcaagtacatccagatatgggaatatcatcaaaagctatgaccatattggacaat gtgatgggagacatgtttgaaagaattgcacaggcagcagcaacgttgtcaacgtacgta gggaggacaacgttttcgtcgagggagattcagggtgctgtgaagatagtgttgcctgga gaacttgggaaacatggcattgctgaaggaactaaagctgtagttagttattttactact gttgctgaagaaaacaagtccaagactaagtga

DBGET integrated database retrieval system