Nicotiana attenuata (coyote tobacco): 109218811 Help Entry 109218811         CDS       T05870                                  Name (RefSeq) SKP1-like protein 3 isoform X1   KO K03094   S-phase kinase-associated protein 1 Organism nau  Nicotiana attenuata (coyote tobacco) Pathway nau03083   Polycomb repressive complex nau04120   Ubiquitin mediated proteolysis nau04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109218811    04120 Ubiquitin mediated proteolysis     109218811   09126 Chromosome    03083 Polycomb repressive complex     109218811  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nau04131]     109218811    04121 Ubiquitin system [BR:nau04121]     109218811    03036 Chromosome and associated proteins [BR:nau03036]     109218811 Membrane trafficking [BR:nau04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     109218811 Ubiquitin system [BR:nau04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      109218811    Cul7 complex      109218811 Chromosome and associated proteins [BR:nau03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      109218811   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      109218811 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Bfc Motif Other DBs NCBI-GeneID:  109218811 NCBI-ProteinID:  XP_019238742 UniProt:  A0A1J6KFD1 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MSSSSVIILKSFDGETIEVEENVVYHSKLIERVCRTIEMNPRIVPLFNVRYNILAKVIDF MKHETEPLMTANGGDVRRSFHAHFLDDVDNDMMVNLVNAAHYMGVESLENYLVGAVQRNF NQNDVNSIGGYFAIP NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgtcttcctcttctgtgatcattctaaagagcttcgatggagaaactatcgaggtggaa gagaatgtggtatatcattccaagctaatcgaacgcgtttgtcgtaccatcgaaatgaat ccccgcattgttcctttgtttaatgtgagatacaacattctcgctaaggtgattgatttt atgaagcacgaaacggagcctctcatgaccgcgaatggaggagatgttcgtcgaagcttt catgctcattttctggacgatgttgacaatgatatgatggtcaatcttgtcaatgcagca cactatatgggagttgagagcctggaaaattacctggttggtgcagtacaaaggaatttc aaccagaacgatgtcaattctattggaggatattttgctataccgtga

DBGET integrated database retrieval system