Nicotiana attenuata (coyote tobacco): 109227748 Help Entry 109227748         CDS       T05870                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism nau  Nicotiana attenuata (coyote tobacco) Pathway nau03083   Polycomb repressive complex nau04120   Ubiquitin mediated proteolysis nau04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109227748    04120 Ubiquitin mediated proteolysis     109227748   09126 Chromosome    03083 Polycomb repressive complex     109227748  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nau04131]     109227748    04121 Ubiquitin system [BR:nau04121]     109227748    03036 Chromosome and associated proteins [BR:nau03036]     109227748 Membrane trafficking [BR:nau04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     109227748 Ubiquitin system [BR:nau04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      109227748    Cul7 complex      109227748 Chromosome and associated proteins [BR:nau03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      109227748   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      109227748 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Pkinase_C Motif Other DBs NCBI-GeneID:  109227748 NCBI-ProteinID:  XP_019248488 LinkDB All DBs Position 6:complement(30569888..30570377) Genome browser AA seq 131 aa AA seqDB search MAEAASSTTEKRFLTLKSSDGDEFELEESIAIQSIHSSTSSNEEDIENFDKEFVSIGFKT IFIILEAANFLDIYSLLELCAEAVDNLIKNKTLEAIWKIFIITSDFTPEEEAEIRNETPW AFEGDLDHSLD NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcagaggcagcatcatcgaccacagagaaaaggtttttgactctgaagtcgtcagat ggtgatgagtttgaattggaagaatccattgccattcagtctattcactcctccacttct tcaaatgaagaagatatcgagaacttcgacaaggaatttgtgagcattggcttcaaaacc atctttataatcttagaagctgcaaatttccttgacatctatagtttgcttgagttgtgc gctgaggcggtggataatttgattaagaacaagacgcttgaagctatttggaagattttc attatcactagtgactttaccccagaagaagaggcagagattcggaatgagactccatgg gcctttgaaggggatcttgatcactcccttgactag

DBGET integrated database retrieval system