Nicotiana attenuata (coyote tobacco): 109236587 Help Entry 109236587         CDS       T05870                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism nau  Nicotiana attenuata (coyote tobacco) Pathway nau04016   MAPK signaling pathway - plant nau04070   Phosphatidylinositol signaling system nau04075   Plant hormone signal transduction nau04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:nau00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     109236587    04070 Phosphatidylinositol signaling system     109236587    04075 Plant hormone signal transduction     109236587  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     109236587  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nau01009]     109236587   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nau04131]     109236587    03036 Chromosome and associated proteins [BR:nau03036]     109236587   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nau04147]     109236587 Protein phosphatases and associated proteins [BR:nau01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109236587 Membrane trafficking [BR:nau04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109236587 Chromosome and associated proteins [BR:nau03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109236587 Exosome [BR:nau04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109236587 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  109236587 NCBI-ProteinID:  XP_019258328 UniProt:  Q5QJ50 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctgaccgatgatcagatctctgagtttaaggaggctttcagcctgttc gataaggacggcgatggttgcattacaactaaggagcttgggacggtgatgaggtcattg ggacagaacccaactgaagctgagctccaggacatgataaatgaagtggatgctgatggt aatggaaccattgacttcccagagtttttgaacctcatggccaggaagatgaaggataca gactcggaggaggagctgaaggaggcattcagagtttttgacaaggaccagaatggtttc atttctgctgctgagctccgtcatgtgatgaccaaccttggtgagaagcttactgatgaa gaagttgatgaaatgattagggaggccgatgtcgatggtgatggacaaattaactatgat gagtttgttaaggtcatgatggccaagtga

DBGET integrated database retrieval system