Nicotiana attenuata (coyote tobacco): 109243014 Help Entry 109243014         CDS       T05870                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nau  Nicotiana attenuata (coyote tobacco) Pathway nau04145   Phagosome nau04148   Efferocytosis nau04620   Toll-like receptor signaling pathway nau05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nau00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109243014    04148 Efferocytosis     109243014  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109243014  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     109243014  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nau04131]     109243014   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nau04147]     109243014    04031 GTP-binding proteins [BR:nau04031]     109243014 Membrane trafficking [BR:nau04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     109243014  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     109243014   Macropinocytosis    Ras GTPases     109243014  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     109243014 Exosome [BR:nau04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109243014   Exosomal proteins of other body fluids (saliva and urine)    109243014   Exosomal proteins of colorectal cancer cells    109243014   Exosomal proteins of bladder cancer cells    109243014 GTP-binding proteins [BR:nau04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     109243014 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  109243014 NCBI-ProteinID:  XP_019265449 UniProt:  A0A314L2L2 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSGSRFIKCVTVGDGAVGKTCLLISYTSNTFPSDYVPTVFDNFSANVVVDGSTINLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASHENVFKKWISELRHYAPGVPIILVGTKL DLREDKQFFLDHPGAVPITTTQGEELRKSIGAAAYIECSAKTQQNVKGVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgggtctcggttcataaagtgtgtgaccgtcggcgacggagcagtgggtaaaact tgtctcctcatttcctataccagcaatacttttccctctgattatgtcccaactgtattt gacaattttagtgcaaatgtggttgtggatggaagcactattaatctgggtctgtgggat actgcaggccaggaggattacaatagattaagacccttgagctatcgtggggcagatgta tttatactagcattttctctcatcagcaaggccagccacgaaaatgtcttcaaaaagtgg atttctgaattgaggcattatgcccctggagttccaatcattcttgttgggacaaagcta gatcttcgtgaggacaagcagttctttttagaccatcctggtgcagtacctattaccacg actcagggtgaagagctaagaaagtcaattggtgctgcggcttacattgaatgtagtgcc aaaacacagcagaatgtgaagggtgtttttgatgcggctattaaggtggttctacaaccg cccaagcagaagaagaaaaagaagagaaagggtcagaaagcctgctctatcttgtga

DBGET integrated database retrieval system