Natronoglycomyces albus: JQS30_03810 Help Entry JQS30_03810       CDS       T07203                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism nav  Natronoglycomyces albus Brite KEGG Orthology (KO) [BR:nav00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     JQS30_03810 Enzymes [BR:nav01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      JQS30_03810 SSDB OrthologParalogGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin Thioredoxin_2 GST_N YfjL_C SH3BGR Redoxin DAGK_cat Motif Other DBs NCBI-ProteinID:  QSB06945 UniProt:  A0A895XUC7 LinkDB All DBs Position complement(914602..914841) Genome browser AA seq 79 aa AA seqDB search MITMYSTTWCGYCRQLKTLLAKEGIDFEEVNIEHDEDAAKWVLEANEGNQTVPTLRFSDD SSLTNPTVAQVKERLASLA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgatcaccatgtattccacaacctggtgcggttactgccgccaattgaagaccttgctg gccaaagagggcattgatttcgaggaagtcaacatcgaacacgatgaggacgccgcgaag tgggtcctggaggccaacgagggcaaccagacggtgccgacgctgcgtttctccgatgat tcgtcgttgacgaacccgacggtcgctcaggtgaaggaacggcttgcctcgttggcgtag

DBGET integrated database retrieval system