Neisseria arctica: LVJ86_01690 Help Entry LVJ86_01690       CDS       T08172                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism naw  Neisseria arctica Pathway naw01100   Metabolic pathways naw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:naw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LVJ86_01690 (acpP)    00074 Mycolic acid biosynthesis     LVJ86_01690 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LVJ86_01690 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 HLH DUF1493 EarP Motif Other DBs NCBI-ProteinID:  UOO86991 LinkDB All DBs Position 394079..394315 Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVNEAEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEEA EKITTVQLAIDYITAHNG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaatattgaacaacaagttaaaaaaattgttgccgaacaattgggtgtgaatgaa gctgaagttaaaaacgaatcttcattccaagacgatttgggtgccgactctctggatacc gttgagttggtaatggctttagaagaagctttcggctgcgaaattcccgacgaagaagct gaaaaaatcactaccgttcagttggcgatcgactatatcaccgctcacaacggttaa

DBGET integrated database retrieval system