KEGG   Neisseria arctica: LVJ86_02410
Entry
LVJ86_02410       CDS       T08172                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
naw  Neisseria arctica
Pathway
naw00770  Pantothenate and CoA biosynthesis
naw01100  Metabolic pathways
naw01240  Biosynthesis of cofactors
Module
naw_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:naw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LVJ86_02410 (coaD)
Enzymes [BR:naw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     LVJ86_02410 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: UOO87123
LinkDB
Position
complement(546414..546932)
AA seq 172 aa
MNQTIRRAVYAGSFDPPTNGHLWMIREAQALFDELIVAIGVNPDKRSTYSVQERIEMLEA
TTKEFPNVRITSFGNRFLVNYARSIDAQFIVRGIRTASDYEYERSMRYINSDLQPQISTV
LLMPPREFAEVSSTMVKGMVGPEGWRDVVRRYIPGPVYEKILRDHETAAKLS
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaaccaaactatccgtcgcgcggtttatgccggcagcttcgaccctcctaccaacggc
catttatggatgatacgcgaagcacaagctttatttgacgaattgatcgttgccatcggc
gttaatcctgacaaacgcagcacatacagcgtacaagaacgcattgaaatgctggaggcc
actaccaaagagtttccaaacgtacgtattacttcgtttggtaatcgttttttagtaaat
tatgcacgcagcatcgacgcccaatttattgtgcgcggcatacgaacagcttcagattat
gaatatgaacgctcaatgcgctatatcaatagtgatttgcagccccaaatctccaccgta
ttgctgatgccgccacgggaatttgccgaagtatcatctacaatggttaaaggcatggtt
ggtccggagggctggcgtgatgtggtacgccgatatattccaggccccgtatatgaaaaa
attctgcgcgaccacgaaactgctgccaaattgtcctga

DBGET integrated database retrieval system