Aquisalimonas sp. 2447: HC341_14410 Help Entry HC341_14410       CDS       T06517                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism nax  Aquisalimonas sp. 2447 Brite KEGG Orthology (KO) [BR:nax00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nax03036]     HC341_14410 (ftsL) Chromosome and associated proteins [BR:nax03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HC341_14410 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF3263 Motif Other DBs NCBI-ProteinID:  QIT56285 UniProt:  A0A6H0IY64 LinkDB All DBs Position complement(3066436..3066723) Genome browser AA seq 95 aa AA seqDB search MNGSALVVSGLAAAVALSALLVIYSQHQSRVLFAELQELNRERDALDAEWGMLRLEQGAW ATHGRVERLAREELDMVMPGRDDVVILRRPSGNRD NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaatggctcggcgctggttgtctccgggctggcggcagcggtggcgctgtcggcactg ctggtgatctacagccagcaccagagccgggtgttgtttgccgaactgcaggagctcaac cgcgagcgtgatgccctggacgccgaatggggcatgttgcgcctggagcagggggcgtgg gccacccatgggcgggtcgagcggctcgctcgcgaggagctggacatggtgatgcccggg cgggatgacgtggtcatcctgcgccggccgtcagggaacagggattga

DBGET integrated database retrieval system