Natronorubrum bangense: DV706_09530 Help Entry DV706_09530       CDS       T05942                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nbg  Natronorubrum bangense Pathway nbg03010   Ribosome Brite KEGG Orthology (KO) [BR:nbg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     DV706_09530   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     DV706_09530  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nbg03011]     DV706_09530    04121 Ubiquitin system [BR:nbg04121]     DV706_09530   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nbg04147]     DV706_09530 Ribosome [BR:nbg03011]  Ribosomal proteins   Eukaryotes    Small subunit     DV706_09530   Archaea     DV706_09530 Ubiquitin system [BR:nbg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    DV706_09530 Exosome [BR:nbg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DV706_09530   Exosomal proteins of colorectal cancer cells    DV706_09530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 Zn_ribbon_Nudix FYVE Ribosomal_L37e Cas12f1-like_TNB Zn_Ribbon_TF Zn_ribbon_3 Zn_ribbon_RPAB4 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  QCC54686 UniProt:  A0A4D6HN33 LinkDB All DBs Position 1895625..1895759 Genome browser AA seq 44 aa AA seqDB search MSRHELYNDDGTTDREMCPRCGDVFLADHGDRTHCGKCGYTEWA NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtcccgacacgaactctacaacgacgacggcaccaccgaccgagaaatgtgtccccgc tgtggcgacgttttccttgctgaccacggcgaccgcacccactgtggcaagtgcggctac accgagtgggcataa

DBGET integrated database retrieval system