Candidatus Nitrosopelagicus brevis: T478_0928 Help Entry T478_0928         CDS       T03537                                  Name (GenBank) ribosomal L40e family protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism nbv  Candidatus Nitrosopelagicus brevis Pathway nbv03010   Ribosome Brite KEGG Orthology (KO) [BR:nbv00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     T478_0928   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     T478_0928  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nbv03011]     T478_0928    04121 Ubiquitin system [BR:nbv04121]     T478_0928 Ribosome [BR:nbv03011]  Ribosomal proteins   Eukaryotes    Large subunit     T478_0928   Archaea     T478_0928 Ubiquitin system [BR:nbv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    T478_0928 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR Zn_Ribbon_1 HypA DUF7129 I-TevI_ZnF DUF7577 CTV_P23 Motif Other DBs NCBI-ProteinID:  AJA93213 UniProt:  A0A0A7V2Y4 LinkDB All DBs Position 756382..756549 Genome browser AA seq 55 aa AA seqDB search MPVADPLKKQIAQKARLHMKICISCGARLDMSATRCRKCRSTQLRLKNRALGIKK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgccagttgcagatcccctaaaaaaacagattgcacaaaaagcaagacttcatatgaaa atctgtatttcatgtggtgcaagattagatatgagcgctacaagatgtagaaaatgtcga agtactcaactaagattgaaaaatagagcactgggaattaaaaagtag

DBGET integrated database retrieval system