Candidatus Nitrosopelagicus brevis: T478_1096 Help Entry T478_1096         CDS       T03537                                  Name (GenBank) ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nbv  Candidatus Nitrosopelagicus brevis Pathway nbv03010   Ribosome Brite KEGG Orthology (KO) [BR:nbv00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     T478_1096   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     T478_1096  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nbv03011]     T478_1096    04121 Ubiquitin system [BR:nbv04121]     T478_1096   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nbv04147]     T478_1096 Ribosome [BR:nbv03011]  Ribosomal proteins   Eukaryotes    Small subunit     T478_1096   Archaea     T478_1096 Ubiquitin system [BR:nbv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    T478_1096 Exosome [BR:nbv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    T478_1096   Exosomal proteins of colorectal cancer cells    T478_1096 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ephrin_rec_like IBR Ribosomal_L37e DUF1451 DZR_2 Motif Other DBs NCBI-ProteinID:  AJA92092 UniProt:  A0A0A7UZB0 LinkDB All DBs Position 901562..901747 Genome browser AA seq 61 aa AA seqDB search MPVEKKGHKGFSPKVSQYYKVDNDKVSRERKTCVRCGKGVFMSEHKNRRTCGKCGDTEFI Q NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgcctgtagagaaaaaaggtcacaaaggattcagtcctaaagtaagtcagtattacaaa gtagataatgacaaagtatcaagagaaagaaaaacatgtgttagatgtggaaagggtgtc tttatgtcagaacataagaatagaagaacctgtggcaaatgtggcgatacagaatttatt caataa

DBGET integrated database retrieval system