Sciurus carolinensis (gray squirrel): 124962389 Help Entry 124962389         CDS       T08117                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar01521   EGFR tyrosine kinase inhibitor resistance ncar01522   Endocrine resistance ncar04010   MAPK signaling pathway ncar04012   ErbB signaling pathway ncar04014   Ras signaling pathway ncar04015   Rap1 signaling pathway ncar04062   Chemokine signaling pathway ncar04068   FoxO signaling pathway ncar04071   Sphingolipid signaling pathway ncar04072   Phospholipase D signaling pathway ncar04137   Mitophagy - animal ncar04140   Autophagy - animal ncar04150   mTOR signaling pathway ncar04151   PI3K-Akt signaling pathway ncar04210   Apoptosis ncar04211   Longevity regulating pathway ncar04213   Longevity regulating pathway - multiple species ncar04218   Cellular senescence ncar04360   Axon guidance ncar04370   VEGF signaling pathway ncar04371   Apelin signaling pathway ncar04540   Gap junction ncar04550   Signaling pathways regulating pluripotency of stem cells ncar04625   C-type lectin receptor signaling pathway ncar04650   Natural killer cell mediated cytotoxicity ncar04660   T cell receptor signaling pathway ncar04662   B cell receptor signaling pathway ncar04664   Fc epsilon RI signaling pathway ncar04714   Thermogenesis ncar04720   Long-term potentiation ncar04722   Neurotrophin signaling pathway ncar04725   Cholinergic synapse ncar04726   Serotonergic synapse ncar04730   Long-term depression ncar04810   Regulation of actin cytoskeleton ncar04910   Insulin signaling pathway ncar04912   GnRH signaling pathway ncar04915   Estrogen signaling pathway ncar04916   Melanogenesis ncar04917   Prolactin signaling pathway ncar04919   Thyroid hormone signaling pathway ncar04921   Oxytocin signaling pathway ncar04926   Relaxin signaling pathway ncar04929   GnRH secretion ncar04933   AGE-RAGE signaling pathway in diabetic complications ncar04935   Growth hormone synthesis, secretion and action ncar05010   Alzheimer disease ncar05022   Pathways of neurodegeneration - multiple diseases ncar05034   Alcoholism ncar05160   Hepatitis C ncar05161   Hepatitis B ncar05163   Human cytomegalovirus infection ncar05165   Human papillomavirus infection ncar05166   Human T-cell leukemia virus 1 infection ncar05167   Kaposi sarcoma-associated herpesvirus infection ncar05170   Human immunodeficiency virus 1 infection ncar05200   Pathways in cancer ncar05203   Viral carcinogenesis ncar05205   Proteoglycans in cancer ncar05206   MicroRNAs in cancer ncar05207   Chemical carcinogenesis - receptor activation ncar05208   Chemical carcinogenesis - reactive oxygen species ncar05210   Colorectal cancer ncar05211   Renal cell carcinoma ncar05213   Endometrial cancer ncar05214   Glioma ncar05215   Prostate cancer ncar05216   Thyroid cancer ncar05218   Melanoma ncar05219   Bladder cancer ncar05220   Chronic myeloid leukemia ncar05221   Acute myeloid leukemia ncar05223   Non-small cell lung cancer ncar05224   Breast cancer ncar05225   Hepatocellular carcinoma ncar05226   Gastric cancer ncar05230   Central carbon metabolism in cancer ncar05231   Choline metabolism in cancer ncar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ncar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124962389    04012 ErbB signaling pathway     124962389    04014 Ras signaling pathway     124962389    04015 Rap1 signaling pathway     124962389    04370 VEGF signaling pathway     124962389    04371 Apelin signaling pathway     124962389    04068 FoxO signaling pathway     124962389    04072 Phospholipase D signaling pathway     124962389    04071 Sphingolipid signaling pathway     124962389    04151 PI3K-Akt signaling pathway     124962389    04150 mTOR signaling pathway     124962389  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124962389    04137 Mitophagy - animal     124962389   09143 Cell growth and death    04210 Apoptosis     124962389    04218 Cellular senescence     124962389   09144 Cellular community - eukaryotes    04540 Gap junction     124962389    04550 Signaling pathways regulating pluripotency of stem cells     124962389   09142 Cell motility    04810 Regulation of actin cytoskeleton     124962389  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     124962389    04650 Natural killer cell mediated cytotoxicity     124962389    04660 T cell receptor signaling pathway     124962389    04662 B cell receptor signaling pathway     124962389    04664 Fc epsilon RI signaling pathway     124962389    04062 Chemokine signaling pathway     124962389   09152 Endocrine system    04910 Insulin signaling pathway     124962389    04929 GnRH secretion     124962389    04912 GnRH signaling pathway     124962389    04915 Estrogen signaling pathway     124962389    04917 Prolactin signaling pathway     124962389    04921 Oxytocin signaling pathway     124962389    04926 Relaxin signaling pathway     124962389    04935 Growth hormone synthesis, secretion and action     124962389    04919 Thyroid hormone signaling pathway     124962389    04916 Melanogenesis     124962389   09156 Nervous system    04725 Cholinergic synapse     124962389    04726 Serotonergic synapse     124962389    04720 Long-term potentiation     124962389    04730 Long-term depression     124962389    04722 Neurotrophin signaling pathway     124962389   09158 Development and regeneration    04360 Axon guidance     124962389   09149 Aging    04211 Longevity regulating pathway     124962389    04213 Longevity regulating pathway - multiple species     124962389   09159 Environmental adaptation    04714 Thermogenesis     124962389  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124962389    05206 MicroRNAs in cancer     124962389    05205 Proteoglycans in cancer     124962389    05207 Chemical carcinogenesis - receptor activation     124962389    05208 Chemical carcinogenesis - reactive oxygen species     124962389    05203 Viral carcinogenesis     124962389    05230 Central carbon metabolism in cancer     124962389    05231 Choline metabolism in cancer     124962389    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     124962389   09162 Cancer: specific types    05210 Colorectal cancer     124962389    05225 Hepatocellular carcinoma     124962389    05226 Gastric cancer     124962389    05214 Glioma     124962389    05216 Thyroid cancer     124962389    05221 Acute myeloid leukemia     124962389    05220 Chronic myeloid leukemia     124962389    05218 Melanoma     124962389    05211 Renal cell carcinoma     124962389    05219 Bladder cancer     124962389    05215 Prostate cancer     124962389    05213 Endometrial cancer     124962389    05224 Breast cancer     124962389    05223 Non-small cell lung cancer     124962389   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124962389    05170 Human immunodeficiency virus 1 infection     124962389    05161 Hepatitis B     124962389    05160 Hepatitis C     124962389    05163 Human cytomegalovirus infection     124962389    05167 Kaposi sarcoma-associated herpesvirus infection     124962389    05165 Human papillomavirus infection     124962389   09164 Neurodegenerative disease    05010 Alzheimer disease     124962389    05022 Pathways of neurodegeneration - multiple diseases     124962389   09165 Substance dependence    05034 Alcoholism     124962389   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124962389   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     124962389   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     124962389    01522 Endocrine resistance     124962389  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncar04131]     124962389   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncar04147]     124962389    04031 GTP-binding proteins [BR:ncar04031]     124962389 Membrane trafficking [BR:ncar04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     124962389  Endocytosis   Macropinocytosis    Ras GTPases     124962389 Exosome [BR:ncar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124962389   Exosomal proteins of other body fluids (saliva and urine)    124962389   Exosomal proteins of breast cancer cells    124962389   Exosomal proteins of colorectal cancer cells    124962389 GTP-binding proteins [BR:ncar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     124962389 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  124962389 NCBI-ProteinID:  XP_047377658 LinkDB All DBs Position 1:106959297..106969883 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaactggtggtggttggagcaggtggtgtgggtaaaagtgcactgaca attcagctaatccagaaccattttgtggatgaatatgatcccaccatagaggattcttat cgaaaacaggtggtaatagatggtgaaacctgtctattggacatactggatacagctgga caagaggagtacagtgccatgagagaccagtatatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaatctctacagggagcagatt aagcgagtaaaagactcagatgatgtacctatggtgctggtaggaaacaagtgtgatttg ccaacaagaacagttgacacaaaacaagcccatgaactggccaagagttacgggataccg ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttctacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgtatgggtttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system