Sciurus carolinensis (gray squirrel): 124963744 Help Entry 124963744         CDS       T08117                                  Name (RefSeq) profilin-4   KO K05759   profilin Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04015   Rap1 signaling pathway ncar04810   Regulation of actin cytoskeleton ncar05014   Amyotrophic lateral sclerosis ncar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     124963744  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     124963744  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124963744   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     124963744  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncar04131]     124963744   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ncar04812]     124963744    04147 Exosome [BR:ncar04147]     124963744 Membrane trafficking [BR:ncar04131]  Others   Actin-binding proteins    Others     124963744 Cytoskeleton proteins [BR:ncar04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      124963744 Exosome [BR:ncar04147]  Exosomal proteins   Proteins found in most exosomes    124963744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  124963744 NCBI-ProteinID:  XP_047379580 LinkDB All DBs Position 13:75826197..75829883 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDSLLGTKHVDSAALIKLHERSVCVATPGFSLMPSDTRTLVNGFAKNPLKTR REGLYFKEQDYKCVRADDYSLYAKNDNGGVVVVKTQQYLLVATYTEGMYPSVCVEATEKL GDYLRKKGH NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccacttgcagaacttactcttagatagcctcctgggaacgaagcacgtggacagc gcggccctcatcaaactccacgagcggagcgtgtgtgtcgcaacaccaggatttagtcta atgccgagtgatacccgaacacttgtgaatggatttgccaaaaaccctttgaaaacccgt agagaaggattgtatttcaaggaacaggattacaaatgtgtccgggcagatgactactct ctttatgcaaagaatgacaacggtggtgtggttgttgtgaagacccaacagtatcttctg gtggccacttatactgaaggaatgtatccaagtgtctgtgtagaagccacagagaaactg ggagactatctaagaaaaaaaggacattaa

DBGET integrated database retrieval system