Sciurus carolinensis (gray squirrel): 124963939 Help Entry 124963939         CDS       T08117                                  Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04010   MAPK signaling pathway ncar04020   Calcium signaling pathway ncar04022   cGMP-PKG signaling pathway ncar04114   Oocyte meiosis ncar04218   Cellular senescence ncar04310   Wnt signaling pathway ncar04360   Axon guidance ncar04370   VEGF signaling pathway ncar04380   Osteoclast differentiation ncar04625   C-type lectin receptor signaling pathway ncar04650   Natural killer cell mediated cytotoxicity ncar04658   Th1 and Th2 cell differentiation ncar04659   Th17 cell differentiation ncar04660   T cell receptor signaling pathway ncar04662   B cell receptor signaling pathway ncar04720   Long-term potentiation ncar04724   Glutamatergic synapse ncar04921   Oxytocin signaling pathway ncar04922   Glucagon signaling pathway ncar04924   Renin secretion ncar05010   Alzheimer disease ncar05014   Amyotrophic lateral sclerosis ncar05020   Prion disease ncar05022   Pathways of neurodegeneration - multiple diseases ncar05031   Amphetamine addiction ncar05152   Tuberculosis ncar05163   Human cytomegalovirus infection ncar05166   Human T-cell leukemia virus 1 infection ncar05167   Kaposi sarcoma-associated herpesvirus infection ncar05170   Human immunodeficiency virus 1 infection ncar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ncar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124963939    04310 Wnt signaling pathway     124963939    04370 VEGF signaling pathway     124963939    04020 Calcium signaling pathway     124963939    04022 cGMP-PKG signaling pathway     124963939  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     124963939    04218 Cellular senescence     124963939  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     124963939    04650 Natural killer cell mediated cytotoxicity     124963939    04660 T cell receptor signaling pathway     124963939    04658 Th1 and Th2 cell differentiation     124963939    04659 Th17 cell differentiation     124963939    04662 B cell receptor signaling pathway     124963939   09152 Endocrine system    04922 Glucagon signaling pathway     124963939    04921 Oxytocin signaling pathway     124963939    04924 Renin secretion     124963939   09156 Nervous system    04724 Glutamatergic synapse     124963939    04720 Long-term potentiation     124963939   09158 Development and regeneration    04360 Axon guidance     124963939    04380 Osteoclast differentiation     124963939  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     124963939   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124963939    05170 Human immunodeficiency virus 1 infection     124963939    05163 Human cytomegalovirus infection     124963939    05167 Kaposi sarcoma-associated herpesvirus infection     124963939   09171 Infectious disease: bacterial    05152 Tuberculosis     124963939   09164 Neurodegenerative disease    05010 Alzheimer disease     124963939    05014 Amyotrophic lateral sclerosis     124963939    05020 Prion disease     124963939    05022 Pathways of neurodegeneration - multiple diseases     124963939   09165 Substance dependence    05031 Amphetamine addiction     124963939   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124963939  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ncar01009]     124963939 Protein phosphatases and associated proteins [BR:ncar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      124963939 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 flgK_1st_1 Motif Other DBs NCBI-GeneID:  124963939 NCBI-ProteinID:  XP_047379620 LinkDB All DBs Position 14:30829495..30830007 Genome browser AA seq 170 aa AA seqDB search MGNEASYPKEMCTHFDHEEIKRLGRSFKKLDFNKSGALSVDEFMSLPELRQNPLVKRVID IFDTDGNGEVDFTEFIRGTSQFSVKGDEEQKLRFAFRIYDLDKDGYISNGELFHVLKMMV GNNLKDWQLQQLVDKTIIILDKDGDGKLSFEEFSAVVKDLEVHKKLIVTV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagttacccgaaggagatgtgcacccactttgaccatgaagaaatt aaaaggctgggcaggagtttcaagaagctggactttaacaagtcgggcgctctgagcgtg gatgagttcatgtccctgcccgagctgcggcagaacccgctggtgaagcgagtgatcgac atcttcgacaccgacggcaacggagaagtggacttcacggaattcatccgggggacctcc cagttcagcgtcaaaggagacgaggagcagaagctgaggttcgcgttccggatctacgac ttagacaaagacggctacatctccaacggggagctcttccacgtgctgaagatgatggtg gggaacaacctcaaggactggcagctacagcagctcgtggacaaaaccatcatcatcctg gataaggatggcgacgggaagttatcctttgaggaattcagtgctgtggtcaaagacctg gaagtccacaagaagttgatagtgactgtgtga

DBGET integrated database retrieval system