Sciurus carolinensis (gray squirrel): 124964014 Help Entry 124964014         CDS       T08117                                  Name (RefSeq) C-C motif chemokine 27-like   KO K16598   C-C motif chemokine 27 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04060   Cytokine-cytokine receptor interaction ncar04061   Viral protein interaction with cytokine and cytokine receptor ncar04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124964014    04061 Viral protein interaction with cytokine and cytokine receptor     124964014  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     124964014  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124964014 Cytokines and neuropeptides [BR:ncar04052]  Cytokines   Chemokines    124964014 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  124964014 NCBI-ProteinID:  XP_047379843 LinkDB All DBs Position 14:37968780..37970236 Genome browser AA seq 113 aa AA seqDB search MKGLLPTSSLLLLLSLLRPDPGAALLLPPSTTTCCTQLYRQPLSSKLLRKVIRVELQEAD GDCHLQAFVLHLARRSVCIHPQNRSLARWFEHQGKRLQGTLPNLNPGLQGKMG NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaaggggctcttgcccaccagcagcctcctgctgctattgtcactcctgagaccagac cctggggcagcattgctactgccacccagcactactacctgctgtactcagctctacaga cagccactctcaagcaagctactgaggaaggtcattcgggtggaactgcaggaggctgat ggggactgtcatctccaggcttttgtgcttcatctggctcgacgcagtgtctgcatccat ccccagaaccgcagcctggctcggtggtttgagcaccaagggaaaaggctccaggggact ctgcccaacctgaatccggggctgcaagggaaaatgggctga

DBGET integrated database retrieval system