Sciurus carolinensis (gray squirrel): 124964683 Help Entry 124964683         CDS       T08117                                  Name (RefSeq) interferon alpha-5-like   KO K05414   interferon alpha Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04060   Cytokine-cytokine receptor interaction ncar04151   PI3K-Akt signaling pathway ncar04217   Necroptosis ncar04620   Toll-like receptor signaling pathway ncar04621   NOD-like receptor signaling pathway ncar04622   RIG-I-like receptor signaling pathway ncar04623   Cytosolic DNA-sensing pathway ncar04630   JAK-STAT signaling pathway ncar04650   Natural killer cell mediated cytotoxicity ncar04936   Alcoholic liver disease ncar05152   Tuberculosis ncar05160   Hepatitis C ncar05161   Hepatitis B ncar05162   Measles ncar05163   Human cytomegalovirus infection ncar05164   Influenza A ncar05165   Human papillomavirus infection ncar05167   Kaposi sarcoma-associated herpesvirus infection ncar05168   Herpes simplex virus 1 infection ncar05169   Epstein-Barr virus infection ncar05170   Human immunodeficiency virus 1 infection ncar05171   Coronavirus disease - COVID-19 ncar05200   Pathways in cancer ncar05320   Autoimmune thyroid disease ncar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     124964683    04151 PI3K-Akt signaling pathway     124964683   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124964683  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     124964683  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124964683    04621 NOD-like receptor signaling pathway     124964683    04622 RIG-I-like receptor signaling pathway     124964683    04623 Cytosolic DNA-sensing pathway     124964683    04650 Natural killer cell mediated cytotoxicity     124964683  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124964683   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     124964683    05161 Hepatitis B     124964683    05160 Hepatitis C     124964683    05171 Coronavirus disease - COVID-19     124964683    05164 Influenza A     124964683    05162 Measles     124964683    05168 Herpes simplex virus 1 infection     124964683    05163 Human cytomegalovirus infection     124964683    05167 Kaposi sarcoma-associated herpesvirus infection     124964683    05169 Epstein-Barr virus infection     124964683    05165 Human papillomavirus infection     124964683   09171 Infectious disease: bacterial    05152 Tuberculosis     124964683   09163 Immune disease    05320 Autoimmune thyroid disease     124964683   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124964683   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     124964683  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124964683 Cytokines and neuropeptides [BR:ncar04052]  Cytokines   Interferons    124964683 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon IL28A Motif Other DBs NCBI-GeneID:  124964683 NCBI-ProteinID:  XP_047381246 LinkDB All DBs Position 14:complement(49644400..49644972) Genome browser AA seq 190 aa AA seqDB search MALPLAVLLALVGLSYKSTCSLGCDLPQIYNLGLETPERNEEGVLMLLEKMRRVPTLSCL NYRKDFAFPQEQTDGEQVQKAQAVSVLHEMTQQVFNLFSTQESFAAWDKILLDTFLTGLY QQLDDLKACVTQQVEVEETPLRALRKYFHSLTVYLKERKHLPCAWEVVRAEIVRSFSSSA NLYGRLRSKE NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atggccttgcccttggctgtcctgctggccctggtggggctcagctacaagtccacctgt tctctgggctgtgacctgcctcagatctacaacctgggtcttgaaactcctgagagaaat gaggagggggtcctgatgctcctggagaaaatgaggagagttcccaccttgtcctgcctc aactacagaaaggactttgccttcccccaggagcagacagatggtgagcaggtgcagaag gctcaagctgtctctgtcctccacgagatgacccagcaggtcttcaacctcttcagcacc caggagtcctttgctgcttgggacaagatcctcctggacacattcctcactggcctctat cagcagctggatgacctgaaagcctgtgtgacccagcaggtggaggtggaagagactccc ctgagggctctgaggaagtacttccacagtctcactgtctacctgaaggagaggaaacac ctcccttgtgcctgggaggtggtcagagcagaaatcgtgagatccttctcttcatcagca aacttgtatggaagactaaggagtaaggaatga

DBGET integrated database retrieval system