Sciurus carolinensis (gray squirrel): 124966277 Help Entry 124966277         CDS       T08117                                  Name (RefSeq) ras-related protein R-Ras2-like   KO K07830   Ras-related protein R-Ras2 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04010   MAPK signaling pathway ncar04014   Ras signaling pathway ncar04024   cAMP signaling pathway ncar04072   Phospholipase D signaling pathway ncar04137   Mitophagy - animal ncar04140   Autophagy - animal ncar04218   Cellular senescence ncar04371   Apelin signaling pathway ncar04625   C-type lectin receptor signaling pathway ncar04810   Regulation of actin cytoskeleton ncar05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124966277    04014 Ras signaling pathway     124966277    04371 Apelin signaling pathway     124966277    04072 Phospholipase D signaling pathway     124966277    04024 cAMP signaling pathway     124966277  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124966277    04137 Mitophagy - animal     124966277   09143 Cell growth and death    04218 Cellular senescence     124966277   09142 Cell motility    04810 Regulation of actin cytoskeleton     124966277  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     124966277  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     124966277  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncar04147]     124966277    04031 GTP-binding proteins [BR:ncar04031]     124966277 Exosome [BR:ncar04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    124966277   Exosomal proteins of bladder cancer cells    124966277 GTP-binding proteins [BR:ncar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     124966277 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  124966277 NCBI-ProteinID:  XP_047383256 LinkDB All DBs Position 16:5528719..5529033 Genome browser AA seq 104 aa AA seqDB search MRGQCMRTGQGFLSAFSVTDRGSFEDICKFQRQILRVKDRDEFPIILIGDKADLDHQRQV TQEEGQQLARQLEVTYMEASAKIRMNVDQAFHELVRVLRKFQEQ NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaggggacagtgcatgaggactggccagggcttcctgtcggccttctcagtcacagac agaggcagttttgaagacatctgtaagtttcaaagacagattctcagagtaaaggatcgt gatgagttcccgattattttaattggtgataaagcagacctggatcatcaaagacaggtg acccaggaggaaggacagcagttagcacggcaacttgaagtaacgtacatggaggcatca gccaagattaggatgaatgtggatcaagcttttcatgaactcgtccgggttttaaggaaa tttcaagagcaataa

DBGET integrated database retrieval system