KEGG   Sciurus carolinensis (gray squirrel): 124970154
Entry
124970154         CDS       T08117                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
ncar  Sciurus carolinensis (gray squirrel)
Pathway
ncar04010  MAPK signaling pathway
ncar04014  Ras signaling pathway
ncar04015  Rap1 signaling pathway
ncar04024  cAMP signaling pathway
ncar04062  Chemokine signaling pathway
ncar04071  Sphingolipid signaling pathway
ncar04145  Phagosome
ncar04148  Efferocytosis
ncar04151  PI3K-Akt signaling pathway
ncar04310  Wnt signaling pathway
ncar04360  Axon guidance
ncar04370  VEGF signaling pathway
ncar04380  Osteoclast differentiation
ncar04510  Focal adhesion
ncar04520  Adherens junction
ncar04530  Tight junction
ncar04613  Neutrophil extracellular trap formation
ncar04620  Toll-like receptor signaling pathway
ncar04650  Natural killer cell mediated cytotoxicity
ncar04662  B cell receptor signaling pathway
ncar04664  Fc epsilon RI signaling pathway
ncar04666  Fc gamma R-mediated phagocytosis
ncar04670  Leukocyte transendothelial migration
ncar04722  Neurotrophin signaling pathway
ncar04810  Regulation of actin cytoskeleton
ncar04932  Non-alcoholic fatty liver disease
ncar04933  AGE-RAGE signaling pathway in diabetic complications
ncar04972  Pancreatic secretion
ncar05014  Amyotrophic lateral sclerosis
ncar05020  Prion disease
ncar05022  Pathways of neurodegeneration - multiple diseases
ncar05100  Bacterial invasion of epithelial cells
ncar05132  Salmonella infection
ncar05135  Yersinia infection
ncar05163  Human cytomegalovirus infection
ncar05167  Kaposi sarcoma-associated herpesvirus infection
ncar05169  Epstein-Barr virus infection
ncar05170  Human immunodeficiency virus 1 infection
ncar05200  Pathways in cancer
ncar05203  Viral carcinogenesis
ncar05205  Proteoglycans in cancer
ncar05208  Chemical carcinogenesis - reactive oxygen species
ncar05210  Colorectal cancer
ncar05211  Renal cell carcinoma
ncar05212  Pancreatic cancer
ncar05231  Choline metabolism in cancer
ncar05415  Diabetic cardiomyopathy
ncar05416  Viral myocarditis
ncar05417  Lipid and atherosclerosis
ncar05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ncar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    124970154
   04014 Ras signaling pathway
    124970154
   04015 Rap1 signaling pathway
    124970154
   04310 Wnt signaling pathway
    124970154
   04370 VEGF signaling pathway
    124970154
   04071 Sphingolipid signaling pathway
    124970154
   04024 cAMP signaling pathway
    124970154
   04151 PI3K-Akt signaling pathway
    124970154
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    124970154
   04148 Efferocytosis
    124970154
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    124970154
   04520 Adherens junction
    124970154
   04530 Tight junction
    124970154
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    124970154
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    124970154
   04620 Toll-like receptor signaling pathway
    124970154
   04650 Natural killer cell mediated cytotoxicity
    124970154
   04662 B cell receptor signaling pathway
    124970154
   04664 Fc epsilon RI signaling pathway
    124970154
   04666 Fc gamma R-mediated phagocytosis
    124970154
   04670 Leukocyte transendothelial migration
    124970154
   04062 Chemokine signaling pathway
    124970154
  09154 Digestive system
   04972 Pancreatic secretion
    124970154
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    124970154
  09158 Development and regeneration
   04360 Axon guidance
    124970154
   04380 Osteoclast differentiation
    124970154
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    124970154
   05205 Proteoglycans in cancer
    124970154
   05208 Chemical carcinogenesis - reactive oxygen species
    124970154
   05203 Viral carcinogenesis
    124970154
   05231 Choline metabolism in cancer
    124970154
  09162 Cancer: specific types
   05210 Colorectal cancer
    124970154
   05212 Pancreatic cancer
    124970154
   05211 Renal cell carcinoma
    124970154
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    124970154
   05163 Human cytomegalovirus infection
    124970154
   05167 Kaposi sarcoma-associated herpesvirus infection
    124970154
   05169 Epstein-Barr virus infection
    124970154
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    124970154
   05135 Yersinia infection
    124970154
   05100 Bacterial invasion of epithelial cells
    124970154
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    124970154
   05020 Prion disease
    124970154
   05022 Pathways of neurodegeneration - multiple diseases
    124970154
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    124970154
   05418 Fluid shear stress and atherosclerosis
    124970154
   05415 Diabetic cardiomyopathy
    124970154
   05416 Viral myocarditis
    124970154
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    124970154
   04933 AGE-RAGE signaling pathway in diabetic complications
    124970154
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncar04131]
    124970154
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncar04147]
    124970154
   04031 GTP-binding proteins [BR:ncar04031]
    124970154
Membrane trafficking [BR:ncar04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    124970154
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    124970154
  Macropinocytosis
   Ras GTPases
    124970154
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    124970154
Exosome [BR:ncar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   124970154
  Exosomal proteins of other body fluids (saliva and urine)
   124970154
  Exosomal proteins of colorectal cancer cells
   124970154
  Exosomal proteins of bladder cancer cells
   124970154
GTP-binding proteins [BR:ncar04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    124970154
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 124970154
NCBI-ProteinID: XP_047389248
LinkDB
Position
18:10633273..10657979
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggcgctgtaggtaaaacttgcctactg
atcagttatacaaccaatgcatttcctggagagtatatccctactgtttttgacaactat
tctgccaatgttatggtagatgggaaaccagtgaatctgggcttatgggatacagctgga
caagaagattatgacagattgcgccccctctcctatccacaaacagatgttttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatccggaa
gtacgacaccactgtcccaacactcctatcatcctagtgggaacaaaacttgatcttaga
gatgataaagacacaattgagaaactgaaggagaagaagctgactcccatcacctatcca
caagggttagccatggctaaggagattggtgctgtaaaatacctggagtgctcagcactc
acacagcgaggcctcaagacagtgtttgatgaagctatccgagcagttctctgcccacct
cctgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system