Sciurus carolinensis (gray squirrel): 124972678 Help Entry 124972678         CDS       T08117                                  Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04814   Motor proteins ncar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ncar00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     124972678  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124972678  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ncar03037]     124972678    04812 Cytoskeleton proteins [BR:ncar04812]     124972678 Cilium and associated proteins [BR:ncar03037]  Motile cilia and associated proteins   Dynein arm    124972678 Cytoskeleton proteins [BR:ncar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      124972678 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  124972678 NCBI-ProteinID:  XP_047393139 LinkDB All DBs Position X:complement(31140650..31152606) Genome browser AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNADEAHNIVKECVDGVLGGEDYNQNNINQWTASIVEQSLTHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccaccgccactgcgatgaggttggtttcaatgctgatgaagcccacaat atcgtcaaagagtgtgtggatggggtcttaggaggtgaggactataatcagaacaacatc aaccagtggactgcaagcatagtggagcaatccctaacacatttggttaagctgggaaag gcttataaatacattgtgacctgtgcagtggtccagaggagtgcatatggctttcacacg gccagctcatgtttttgggataccacatctgatggaacctgtactgtaagatgggagaac cgaaccatgaactgcattgtcaatgtttttgcgattgcaattgtcctttaa

DBGET integrated database retrieval system