Sciurus carolinensis (gray squirrel): 124974413 Help Entry 124974413         CDS       T08117                                  Name (RefSeq) polyubiquitin-B-like   KO K08770   ubiquitin B/C Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04120   Ubiquitin mediated proteolysis ncar04137   Mitophagy - animal ncar04140   Autophagy - animal ncar05012   Parkinson disease ncar05022   Pathways of neurodegeneration - multiple diseases ncar05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:ncar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124974413  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124974413    04137 Mitophagy - animal     124974413  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     124974413  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     124974413   09164 Neurodegenerative disease    05012 Parkinson disease     124974413    05022 Pathways of neurodegeneration - multiple diseases     124974413  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ncar04121]     124974413   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncar04147]     124974413 Ubiquitin system [BR:ncar04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    124974413 Exosome [BR:ncar04147]  Exosomal proteins   Exosomal proteins of breast milk    124974413   Exosomal proteins of other body fluids (saliva and urine)    124974413   Exosomal proteins of colorectal cancer cells    124974413   Exosomal proteins of bladder cancer cells    124974413 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Plexin_RBD Motif Other DBs NCBI-GeneID:  124974413 NCBI-ProteinID:  XP_047393648 LinkDB All DBs Position Unknown AA seq 185 aa AA seqDB search MEDSTLSDYNIQESTLHLVLCLRGGMHIFLKTLKGTNITLQVEPSDTIELEYGCTLSDYN SKKESTLYLVLYLLGGLQIFMKSLTDTTITLEVETSDTIETVKAKIQDKEDGDICWQQLE DWCTFPDQHIQKEYTQNLVLHLQGGMQIFVKTLTGKTFTLEVDPSDTIENGKAKMQDKES NLPDQ NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atggaagacagcacgctatctgactacaacatccaggagtccacactgcacctggtgctg tgcctcagaggtgggatgcacatcttcctgaagaccctgaaaggcacaaacatcactctg caggttgagcccagtgacaccattgagctggaatatgggtgcaccctatctgactacaac tccaagaaggagtccaccctgtacctggtgctgtacctcttaggtgggttgcagatcttc atgaagtccttgaccgacaccaccatcaccctggaggtggagaccagtgacaccattgag actgtcaaggcaaaaattcaagacaaggaagatggtgacatttgctggcaacagttagaa gactggtgcacctttcctgaccaacacatccagaaggagtacacccagaacctggtgctg cacctccaaggtgggatgcagattttcgtgaagacactgacaggcaagaccttcaccctg gaggtggatcccagtgacaccattgagaatggcaaggcaaagatgcaagacaaggaaagc aatcttcctgaccagtaa

DBGET integrated database retrieval system