Sciurus carolinensis (gray squirrel): 124976128 Help Entry 124976128         CDS       T08117                                  Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar01521   EGFR tyrosine kinase inhibitor resistance ncar01524   Platinum drug resistance ncar04014   Ras signaling pathway ncar04064   NF-kappa B signaling pathway ncar04115   p53 signaling pathway ncar04137   Mitophagy - animal ncar04140   Autophagy - animal ncar04151   PI3K-Akt signaling pathway ncar04210   Apoptosis ncar04215   Apoptosis - multiple species ncar04621   NOD-like receptor signaling pathway ncar04630   JAK-STAT signaling pathway ncar05012   Parkinson disease ncar05014   Amyotrophic lateral sclerosis ncar05022   Pathways of neurodegeneration - multiple diseases ncar05145   Toxoplasmosis ncar05162   Measles ncar05166   Human T-cell leukemia virus 1 infection ncar05168   Herpes simplex virus 1 infection ncar05170   Human immunodeficiency virus 1 infection ncar05200   Pathways in cancer ncar05202   Transcriptional misregulation in cancer ncar05212   Pancreatic cancer ncar05220   Chronic myeloid leukemia ncar05222   Small cell lung cancer ncar05225   Hepatocellular carcinoma ncar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     124976128    04630 JAK-STAT signaling pathway     124976128    04064 NF-kappa B signaling pathway     124976128    04151 PI3K-Akt signaling pathway     124976128  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124976128    04137 Mitophagy - animal     124976128   09143 Cell growth and death    04210 Apoptosis     124976128    04215 Apoptosis - multiple species     124976128    04115 p53 signaling pathway     124976128  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     124976128  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124976128    05202 Transcriptional misregulation in cancer     124976128   09162 Cancer: specific types    05212 Pancreatic cancer     124976128    05225 Hepatocellular carcinoma     124976128    05220 Chronic myeloid leukemia     124976128    05222 Small cell lung cancer     124976128   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124976128    05170 Human immunodeficiency virus 1 infection     124976128    05162 Measles     124976128    05168 Herpes simplex virus 1 infection     124976128   09174 Infectious disease: parasitic    05145 Toxoplasmosis     124976128   09164 Neurodegenerative disease    05012 Parkinson disease     124976128    05014 Amyotrophic lateral sclerosis     124976128    05022 Pathways of neurodegeneration - multiple diseases     124976128   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124976128   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     124976128    01524 Platinum drug resistance     124976128  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ncar01009]     124976128   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ncar03036]     124976128   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ncar02000]     124976128 Protein phosphatases and associated proteins [BR:ncar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      124976128 Chromosome and associated proteins [BR:ncar03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     124976128 Transporters [BR:ncar02000]  Other transporters   Pores ion channels [TC:1]    124976128 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  124976128 NCBI-ProteinID:  XP_047394850 LinkDB All DBs Position 2:25354632..25407128 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEDNRTEAPEGTESEVETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagcgatgtggaagataataggactgaagccccagaaggg actgaatcagaggtggagacccccagtgccatcaatggcaacccatcctggcatctggcg gacagccctgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtgaagcaagctctgagggaggcaggcgatgagtttgaactgcgg taccggcgggcattcagtgacctgacgtcccagctccacatcaccccggggacagcatat cagagctttgaacaggtagtgaacgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcaagttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaataacgcggcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system