Sciurus carolinensis (gray squirrel): 124979224 Help Entry 124979224         CDS       T08117                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04613   Neutrophil extracellular trap formation ncar05034   Alcoholism ncar05203   Viral carcinogenesis ncar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ncar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124979224  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     124979224   09163 Immune disease    05322 Systemic lupus erythematosus     124979224   09165 Substance dependence    05034 Alcoholism     124979224  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ncar03036]     124979224   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncar04147]     124979224 Chromosome and associated proteins [BR:ncar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     124979224 Exosome [BR:ncar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124979224 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  124979224 NCBI-ProteinID:  XP_047399666 LinkDB All DBs Position 1:99562702..99563444 Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagatccagcgaaatctgctcctgctcccaagaaggggtcgaaaaaggctgttaca aaagtacagaagaaggacggcaagaagcgtaagcgcagccgaaaggagagctattccgtt tacgtgtacaaggtgttgaagcaggtccaccctgacactggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatctttgagcgcatcgctggtgaagcttctcgc ctggcgcattacaacaagcgctccaccatcacttctcgggagatccagacggcagtgcgc ctgctgctgccgggcgagctggccaagcacgcagtgtccgagggtaccaaggccgtcacc aagtacaccagctcgaagtaa

DBGET integrated database retrieval system