Sciurus carolinensis (gray squirrel): 124979281 Help Entry 124979281         CDS       T08117                                  Name (RefSeq) tachykinin-4-like   KO K05241   tachykinin 4 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04080   Neuroactive ligand-receptor interaction ncar04082   Neuroactive ligand signaling Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     124979281    04082 Neuroactive ligand signaling     124979281  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124979281 Cytokines and neuropeptides [BR:ncar04052]  Neuropeptides   GPCR binding    124979281 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tachykinin Motif Other DBs NCBI-GeneID:  124979281 NCBI-ProteinID:  XP_047399750 LinkDB All DBs Position 3:complement(25669506..25672744) Genome browser AA seq 74 aa AA seqDB search MLPCLTLLLLVGPSVSSATGDSGEELALSAEARPWVTLILEEDAVPSIQLQLQEGKRSKA NQFFGLMGKQVEGE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgctgccctgcctcaccctgcttctcctggtagggccgtctgtgtcctccgcaacaggg gacagtggagaggaactggcactcagcgctgaagcaaggccctgggtgaccctgatctta gaggaggacgctgtccccagcattcagctccagctgcaggaggggaagaggagcaaggcg aaccagttctttggactgatggggaagcaggtggaaggtgagtga

DBGET integrated database retrieval system