Sciurus carolinensis (gray squirrel): 124980670 Help Entry 124980670         CDS       T08117                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04060   Cytokine-cytokine receptor interaction ncar04061   Viral protein interaction with cytokine and cytokine receptor ncar04062   Chemokine signaling pathway ncar04620   Toll-like receptor signaling pathway ncar05142   Chagas disease ncar05163   Human cytomegalovirus infection ncar05323   Rheumatoid arthritis ncar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124980670    04061 Viral protein interaction with cytokine and cytokine receptor     124980670  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124980670    04062 Chemokine signaling pathway     124980670  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     124980670   09174 Infectious disease: parasitic    05142 Chagas disease     124980670   09163 Immune disease    05323 Rheumatoid arthritis     124980670   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124980670  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124980670    00536 Glycosaminoglycan binding proteins [BR:ncar00536]     124980670 Cytokines and neuropeptides [BR:ncar04052]  Cytokines   Chemokines    124980670 Glycosaminoglycan binding proteins [BR:ncar00536]  Heparan sulfate / Heparin   Chemokines    124980670 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  124980670 NCBI-ProteinID:  XP_047402436 LinkDB All DBs Position 3:complement(37412775..37415026) Genome browser AA seq 93 aa AA seqDB search MEVSMAVLAVLFFTEALSSQTCSASLGADSPTACCFFYISRKIPRKFVDDYYETSSQCSK PAVIFQTKRGRQVCADPSQAWVRAYITDLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaggtctccatggccgtccttgctgtcctgttcttcacggaggccctctcctcccag acctgctctgcctccttgggtgccgacagccccaccgcctgctgcttcttctacatctcc cggaagattccgcgcaaattcgtagatgactattatgagaccagcagccagtgctccaaa ccggctgtcatcttccagaccaagagaggccggcaggtctgtgctgaccccagccaggcc tgggttcgagcctacatcaccgacctggagctgaacgcctga

DBGET integrated database retrieval system