Sciurus carolinensis (gray squirrel): 124980787 Help Entry 124980787         CDS       T08117                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar03010   Ribosome ncar04120   Ubiquitin mediated proteolysis ncar04137   Mitophagy - animal ncar04140   Autophagy - animal ncar05012   Parkinson disease ncar05022   Pathways of neurodegeneration - multiple diseases ncar05167   Kaposi sarcoma-associated herpesvirus infection ncar05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:ncar00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     124980787   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124980787  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124980787    04137 Mitophagy - animal     124980787  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     124980787    05167 Kaposi sarcoma-associated herpesvirus infection     124980787   09164 Neurodegenerative disease    05012 Parkinson disease     124980787    05022 Pathways of neurodegeneration - multiple diseases     124980787  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ncar03011]     124980787    04121 Ubiquitin system [BR:ncar04121]     124980787 Ribosome [BR:ncar03011]  Ribosomal proteins   Eukaryotes    Large subunit     124980787   Archaea     124980787 Ubiquitin system [BR:ncar04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    124980787 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Dsc3_N TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2604 OTU1_UBXL Motif Other DBs NCBI-GeneID:  124980787 NCBI-ProteinID:  XP_047402653 LinkDB All DBs Position 3:115937517..115937909 Genome browser AA seq 125 aa AA seqDB search MQIFVKTLMCKTITLEVEPSDTIENVKAKIQDKEGIPSDQQRLIFAGKQLEDGCTLSDYN IQKESTLHLVLCLRGGIIEPSLHQLAQKYNCDKMICPKCYARQHLRAVKKKCGHTNNLCP RNKVK NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctgatgtgcaagaccatcaccctcgaggttgagcccagt gacaccattgagaatgtcaaagccaaaattcaagacaaggagggcatcccatctgaccag cagcgtctgatttttgcgggcaaacagctggaggatggctgcactctctcagattacaac atccagaaagagtccaccctgcacttggtgctttgcctgcgaggtggcatcattgagcct tccctgcaccagcttgcccagaagtacaactgtgacaagatgatctgtcccaagtgttat gcccgccagcacctccgtgctgtcaagaagaagtgtggtcacaccaacaacctctgccct aggaataaggtcaaataa

DBGET integrated database retrieval system