Sciurus carolinensis (gray squirrel): 124980888 Help Entry 124980888         CDS       T08117                                  Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04022   cGMP-PKG signaling pathway ncar04081   Hormone signaling ncar04270   Vascular smooth muscle contraction ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     124980888   09133 Signaling molecules and interaction    04081 Hormone signaling     124980888  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     124980888  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     124980888  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124980888 Cytokines and neuropeptides [BR:ncar04052]  Neuropeptides   Unclassified    124980888 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  124980888 NCBI-ProteinID:  XP_047402882 LinkDB All DBs Position 3:complement(175622872..175627155) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRSSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctcgcctgcgctctgctgctcacgctcctctccctccggtcc tctgaagccaagcccggggcgccaccgaaggtcccacgaaccccgccaggggaggagctg gctgagccccaggctgctggcggcggtcagaagaagggcgacaagactcctgggggcggc ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggcagcgtgggcccgccttcttcatgagcaccctaacgcgcgcaaatacaaagga ggcaacaagaagggcttgtccaaaggctgctttggcctcaaactggaccggatcggctcc atgagtggcctgggatgttag

DBGET integrated database retrieval system