Sciurus carolinensis (gray squirrel): 124982054 Help Entry 124982054         CDS       T08117                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04382   Cornified envelope formation ncar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ncar00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     124982054  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124982054  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncar04147]     124982054 Exosome [BR:ncar04147]  Exosomal proteins   Exosomal proteins of microglial cells    124982054 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  124982054 NCBI-ProteinID:  XP_047404219 LinkDB All DBs Position 1:97586446..97596319 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaaccatgatgtttacatttcacaaatttgcc ggagataaaggctatttaaccaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaggacctggac cagtgcagagatggcaaagtgggcttccagagcttcttttcgctaatcgcaggcctcacc attgcatgcaatgactattttgtagtacacatgaaacagaagggaaagaagtaa

DBGET integrated database retrieval system