Sciurus carolinensis (gray squirrel): 124984662 Help Entry 124984662         CDS       T08117                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04621   NOD-like receptor signaling pathway ncar05012   Parkinson disease ncar05132   Salmonella infection ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     124984662  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124984662   09164 Neurodegenerative disease    05012 Parkinson disease     124984662   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     124984662  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ncar03110]     124984662 Chaperones and folding catalysts [BR:ncar03110]  Protein folding catalysts   Protein disulfide isomerase    124984662 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 Thioredoxin_9 Thioredoxin_7 Glutaredoxin AhpC-TSA OST3_OST6 Redoxin Motif Other DBs NCBI-GeneID:  124984662 NCBI-ProteinID:  XP_047408519 LinkDB All DBs Position 5:complement(157424123..157424716) Genome browser AA seq 105 aa AA seqDB search MVKQVDSKEVFQEALAAAGDKLVVVDFSANWCGPCKMIKPFLHSLSEKYSDVLFLEVDVD ACQDVAAECEVKCMPTFQFFKKGQKVGEFSGTNKEKLKATINEFL NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcaggtcgacagcaaggaagtttttcaggaagctttggcggctgcaggagac aaacttgtagtagttgacttctcagccaactggtgcggcccttgcaaaatgatcaagcct ttccttcattccctctctgaaaaatattccgacgtcttgttcctggaagtagatgtagat gcctgccaggatgtcgctgcagagtgtgaagtcaaatgcatgcccaccttccagtttttc aaaaaaggtcaaaaggtgggtgagttttctggaactaacaaggaaaagcttaaagccacc attaatgaatttctctaa

DBGET integrated database retrieval system