KEGG   Sciurus carolinensis (gray squirrel): 124986295
Entry
124986295         CDS       T08117                                 
Name
(RefSeq) probable UDP-sugar transporter protein SLC35A4
  KO
K15273  solute carrier family 35 (probable UDP-sugar transporter), member A4
Organism
ncar  Sciurus carolinensis (gray squirrel)
Brite
KEGG Orthology (KO) [BR:ncar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ncar02000]
    124986295
Transporters [BR:ncar02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   124986295
SSDB
Motif
Pfam: Nuc_sug_transp EamA
Other DBs
NCBI-GeneID: 124986295
NCBI-ProteinID: XP_047410679
LinkDB
Position
6:98822394..98823617
AA seq 323 aa
MSVEEGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELT
KLLLCAFSLLVGWQAWPRGAPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSN
LKIGSTALFYCLCLRHRLSARQGLALLLLMAAGACYAAGGLQDPGNTLPGPPAAAASSMP
LHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQNLFLYTFGVLLNLGLHAGGGP
GPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAMLSAALLRLQ
LTATFFLATLLIGLAVRLYYGSH
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagtgtagaggaaggtggtatgccaggcctgggccgacccaggcaggcccgctggacc
ctgatgctcctcctgtccactgccatgtatggtgcccatgccccactgttggcgctgtgc
catgtggatggccgagtgccttttcggccctcctcagctgtgctgctcactgagctgacc
aagctactattgtgcgccttctcccttctcgtgggctggcaagcatggccccgaggggcc
ccaccctggcgccaggctgcgccttttgcactctctgccctgctctatggcgccaacaac
aacctggtgatctatctacagcgttacatggaccccagtacctaccaggtgctgagcaat
ctcaagattggaagcacagccctgttctactgcctctgcctccggcaccgtctctctgca
cgccagggtttggcactgctgctgctcatggctgcaggggcctgctatgcagcaggtggc
cttcaggaccctgggaacacccttcctgggcctccagcagctgctgccagctccatgccc
ctgcatatcactccactgggactgctgctgctcatcctgtactgtctcatctcaggcttg
tcatctgtgtacacagaactgctcatgaagcgacagcgtctgcccctggcacttcaaaat
cttttcctctatacttttggtgtgctcctgaaccttggtctgcatgcaggcggtggtcct
ggcccaggcctcctggagggtttctcaggatgggcagcacttgtggtgctgagccaggca
ctaaatggactgctcatgtcagctgtcatgaagcacggcagcagcatcacacgcctcttc
gttgtgtcctgctcattggtggtcaatgccatgctttcagcagctctgctacggctgcaa
cttacagctaccttcttcctggccacactgctcatcggcctggctgtgcgcctatactat
ggtagccactag

DBGET integrated database retrieval system