Sciurus carolinensis (gray squirrel): 124986433 Help Entry 124986433         CDS       T08117                                  Name (RefSeq) interleukin-3-like   KO K04736   interleukin 3 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04060   Cytokine-cytokine receptor interaction ncar04151   PI3K-Akt signaling pathway ncar04210   Apoptosis ncar04630   JAK-STAT signaling pathway ncar04640   Hematopoietic cell lineage ncar04664   Fc epsilon RI signaling pathway ncar05200   Pathways in cancer ncar05202   Transcriptional misregulation in cancer ncar05221   Acute myeloid leukemia ncar05310   Asthma Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     124986433    04151 PI3K-Akt signaling pathway     124986433   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124986433  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     124986433  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     124986433    04664 Fc epsilon RI signaling pathway     124986433  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124986433    05202 Transcriptional misregulation in cancer     124986433   09162 Cancer: specific types    05221 Acute myeloid leukemia     124986433   09163 Immune disease    05310 Asthma     124986433  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124986433    00536 Glycosaminoglycan binding proteins [BR:ncar00536]     124986433 Cytokines and neuropeptides [BR:ncar04052]  Cytokines   Interleukins    124986433 Glycosaminoglycan binding proteins [BR:ncar00536]  Heparan sulfate / Heparin   Cytokines    124986433 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL3 Motif Other DBs NCBI-GeneID:  124986433 NCBI-ProteinID:  XP_047410753 LinkDB All DBs Position 6:complement(138246744..138248595) Genome browser AA seq 175 aa AA seqDB search MHPASRNPSSLSTLLLLLFLLSCSGLRTAKGLPLNTGNANVTICNATIREIRKQLEESKP LPLNSADGEDRWLLQNASRRLNLCEFLKAAETLTDKQKIKTSLKCLMQCLPRVEPTVTDS RIIFIKEGNWNDFRKKLQYYLHILGEELDSALNPRIPYPTSGSVPRSSQNGTLEC NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgcatcctgccagccggaaccccagcagcctctctaccctgctcctgctcctattcctc ctctcctgctctggtctccgaactgccaaggggctgcccttgaacactgggaacgccaat gtgacgatttgcaatgcaacgatccgggaaattagaaagcaactagaggagtctaagcct ttgcctttgaactcggctgatggggaagaccgatggctcttgcagaatgcctctcggagg ctaaacctgtgtgaattcttgaaagctgccgagactttgactgacaaacagaaaatcaag actagtcttaagtgtctcatgcaatgcctgcccagggttgagcccacagtcacagactcg agaataatctttatcaaagagggcaactggaatgacttccggaagaaactgcagtactat ctgcacattcttggtgaagagctggattcagcattgaaccccagaatcccctatccgaca tctggttcagtccctcggtcttctcaaaatgggaccttggaatgttag

DBGET integrated database retrieval system