Sciurus carolinensis (gray squirrel): 124988094 Help Entry 124988094         CDS       T08117                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04613   Neutrophil extracellular trap formation ncar05034   Alcoholism ncar05202   Transcriptional misregulation in cancer ncar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ncar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124988094  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     124988094   09163 Immune disease    05322 Systemic lupus erythematosus     124988094   09165 Substance dependence    05034 Alcoholism     124988094  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ncar03036]     124988094   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncar04147]     124988094 Chromosome and associated proteins [BR:ncar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     124988094 Exosome [BR:ncar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124988094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  124988094 NCBI-ProteinID:  XP_047413235 LinkDB All DBs Position 7:complement(154544004..154545444) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgtaccaagcaaacagcccgcaagtccaccggcggcaaggcgccgcgcaagcag ttggctaccaaagccgcccgcaagagtgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcaccgtggcgctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system