Sciurus carolinensis (gray squirrel): 124988206 Help Entry 124988206         CDS       T08117                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04613   Neutrophil extracellular trap formation ncar05034   Alcoholism ncar05202   Transcriptional misregulation in cancer ncar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ncar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124988206  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     124988206   09163 Immune disease    05322 Systemic lupus erythematosus     124988206   09165 Substance dependence    05034 Alcoholism     124988206  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ncar03036]     124988206   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncar04147]     124988206 Chromosome and associated proteins [BR:ncar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     124988206 Exosome [BR:ncar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124988206 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  124988206 NCBI-ProteinID:  XP_047413437 LinkDB All DBs Position 7:130693787..130695176 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcaccaagcagactgcgcgcaagtccacaggcggcaaggcaccgcgcaagcag ctggccaccaaggctgcccgcaagagcgcgccggccaccggcggcgtcaagaagccccac cgctaccggcccggcaccgtggcgctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatagcgcaggacttcaag accgacctgcgcttccagagctcggcggtcatggcgctgcaggaggcctgcgaggcctac ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagagggcctga

DBGET integrated database retrieval system