Sciurus carolinensis (gray squirrel): 124988224 Help Entry 124988224         CDS       T08117                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04613   Neutrophil extracellular trap formation ncar05034   Alcoholism ncar05203   Viral carcinogenesis ncar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ncar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124988224  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     124988224   09163 Immune disease    05322 Systemic lupus erythematosus     124988224   09165 Substance dependence    05034 Alcoholism     124988224  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ncar03036]     124988224 Chromosome and associated proteins [BR:ncar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     124988224 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  124988224 NCBI-ProteinID:  XP_047413455 LinkDB All DBs Position 7:130655116..130655753 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggaaaaggaggcaaaggcctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccgccgcctggcccgc cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacgcgcggggtgctcaag gtcttcctggagaacgtcatccgcgacgcggtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcacgctctacggc ttcggcggctga

DBGET integrated database retrieval system