Sciurus carolinensis (gray squirrel): 124988512 Help Entry 124988512         CDS       T08117                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04360   Axon guidance ncar04666   Fc gamma R-mediated phagocytosis ncar04810   Regulation of actin cytoskeleton ncar05133   Pertussis ncar05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:ncar00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     124988512  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     124988512   09158 Development and regeneration    04360 Axon guidance     124988512  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     124988512   09171 Infectious disease: bacterial    05133 Pertussis     124988512  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncar04131]     124988512   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ncar04812]     124988512    04147 Exosome [BR:ncar04147]     124988512 Membrane trafficking [BR:ncar04131]  Others   Actin-binding proteins    Others     124988512 Cytoskeleton proteins [BR:ncar04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      124988512 Exosome [BR:ncar04147]  Exosomal proteins   Proteins found in most exosomes    124988512 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  124988512 NCBI-ProteinID:  XP_047413980 LinkDB All DBs Position 7:complement(13637623..13638012) Genome browser AA seq 129 aa AA seqDB search MTSGCSDGIGKVFRDMKEHTSSAPEGGRKCKEEVLCPSEDKNAPSRGGQGVLVVVWAGLD DLPTTFVRMLPDKDCLSASVMQRRRPRRVRRSTCVYLLAPESTPLKSKTICTSSKDAIKW KLTGIRQDL NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgacctctgggtgctctgatggcatcggcaaggtgttccgtgacatgaaggagcacaca tcatcagcaccagagggagggaggaagtgcaaggaggaggtcctctgcccgagtgaggac aagaacgccccatcccgaggaggccagggggtcctggtggtggtgtgggccgggctggat gacctccccaccacctttgtcaggatgctgccagacaaggactgcctctctgcctctgtg atgcaacgtaggagaccaaggagagtgagaaggagcacctgtgtttaccttctggctcct gagtctacaccccttaagagcaaaaccatctgtactagttccaaggatgccatcaagtgg aagctgacagggatcaggcaggatttataa

DBGET integrated database retrieval system